CDS Views for Sustainability Content Infrastructure (EHS-SUS-CI)

CDS View NameDescriptionSQL View Name
A_CMPLNCPRPSCompliance PurposeACMPLNCPRPS
A_CMPLNCPRPSRQMTASSGMTCompl. Purpose Requirement AssignmentACMPPRPSRQASSGMT
A_CMPLNCPRPSTEXTCompliance Purpose DescriptionACMPLNCPRPSTXT
C_CMPLNCPRPSACTVTNSTSVHCompliance Purpose Activation Status VHCCPACTVTNSTSVH
C_CMPLNCPRPSNAMEWITHFALLBACKCompliance Purpose Name with FallbackCCPNAMEFALLBACK
C_CMPLNCPRPSRQMTASSGMTTPPurpose CR Assignment Consumption ViewCCPCRASSGMTTP
C_CMPLNCPRPSTEXTTPCompliance Purpose Text Consumption ViewCCMPLNCPRPSTTP
C_CMPLNCPRPSTPCompliance PurposeCCMPLNCPRPSTP
C_CMPLRQDOMAINVALUEHELPCompliance Requirement Domain Value HelpCCMPLRQDOMVH
C_CMPLRQENVRMTDOMAINVHCompl. Requirement Env. Domain Value HelpCCMPLRQENVRDOMVH
C_CMPLRQPRPSDRFTVHCmplRq VH Draft Consumption ViewCCMPLRQPRPSDVH
C_CMPLRQVERSACTVTNCompliance Requirement Version ActivationCCRVACTVN
C_CMPLRQVERSCMPLNCSTMNTVHCR Version Compliance StatementCCRVCMPLSTMNTVH
C_CMPLRQVERSEXEMPTIONSUBSTVHExemption Value Help for SubstancesCCRVEXMPSUBVH
C_CMPLRQVERSEXEMPTIONVHCR Version ExemptionCCRVEXMPVH
C_CMPLRQVERSMNTRGLISTSLSQQuery for Monitoring List Sales AnlytsCCRVMLSLSQ
C_CMPLRQVERSMNTRGPRODNQQuery for Monitoring List Products AnalyticsCCRVMLPRDQ
C_CMPLRQVERSMNTRGSUPLRQQuery for Monitoring List Supplier AnalyticsCCRVMLSUPQ
C_CMPLRQVERSPRODACTNVHProvides product based actions of a requirementCCRVPRDACTNVH
C_CMPLRQVERSSUBSTACTNVHProvides substance based actions of a requirementCCRVSUBSTACTNVH
C_CMPLRQVHCmplRq VH Consumption ViewCCMPLRQVH
C_EHSCMPLNCRQMTRELATEDTASKEHS CR Task, task definitions and instances for paragraphCEHSREQTASKREL
C_EHSCMPLNCRQMTSTRUCTSKDEFCompl. Req. Structure Task DefinitionsCEHSREQSTRTSKDEF
C_EHSCMPLNCRQMTTSKDEFCompliance Requirement Task DefinitionsCEHSCMPLRQTSKDEF
C_EHSCMPLNCRQMTTSKDEFANDINSTCEEHS CR Task, definitions and instancesCEHSREQTASKALL
C_EHSCMPLRQIMPRTEXTREGULATIONSCompliance Requirement IntegrationCEHSCREQEXTREG
C_EHSCMPLRQIMPRTEXTUPDATECompliance Req. Integration UpdateCEHSCREQEXTUPD
C_LISTEDSUBSTANCEINPUTFIELDInput Field for Listed SubstanceCLISUINPUT
C_LISTEDSUBSTANCEVARIANTVHListed Substance Variant Value HelpCLISUVARVH
C_LISTEDSUBSTANCEVHListed Substance Value HelpCLISUROOTVH
C_PRODCMPLNCPHRSCONTEXTVHValue Help for ContextCPHRSCONTEXTVH
C_PRODCMPLNCPHRSEXTRASMALLVHPhrasesCPCPHRSXSVH
C_PRODCMPLNCPHRSLANGUAGEVHValue Help for LanguagesCPHRSLANGUVH
C_PRODCMPLNCPHRSTXTWTHFALLBACKText for every Phrase in every LanguageCPHRSTXTFB
C_PRODCMPLNCPHRSVHPhrasesCPCPHRSVH
EHFNDV_INVALID_PHRS2008Invalid Phrases in CE2008PCINVLDPHRS2008
EHFNDV_INVALID_PHRS_COUNT2008Invalid Phrases in CE2008PCINVPRSCNT2008
EHFNDV_PHRS_MIGRATION_STS2008Migration Status for Phrases in CE2008PHRSMIGR2008
EHFND_LISU_NAMEName of a listed substanceEHFNDV_LISUNAME
EHFND_REGL_NAMEDetermines the name of an agentEHFNDV_REGL_NAME
I_CMPLNCPRPSCompliance PurposeICMPLNCPRPS
I_CMPLNCPRPSACTVTNCompliance Purpose ActivationICPACTVTN
I_CMPLNCPRPSACTVTNTEXTCompliance Purpose Activation TextICPACTVTNT
I_CMPLNCPRPSACTVTNTPCompliance Purpose Activation Transactional ViewICPACTVTNTP
I_CMPLNCPRPSDIMENSIONCompliance PurposeICP_DIMENSION
I_CMPLNCPRPSRQMTASSGMTCompliance Purpose CR AssignmentICPCRASSGMT
I_CMPLNCPRPSRQMTASSGMTDRAFTPurpose CmplRq Assgmt Draft ViewICPCRASSGMTDR
I_CMPLNCPRPSRQMTASSGMTTPPurpose CR Assignment Transactional ViewICPCRASSGMTTP
I_CMPLNCPRPSSTDVHCompliance PurposeICP__VH
I_CMPLNCPRPSTEXTCompliance Purpose Text ViewICMPLNCPRPST
I_CMPLNCPRPSTEXTTPCompliance Purpose Text Transactional ViewICMPLNCPRPSTTP
I_CMPLNCPRPSTPCompliance Purpose Transactional ViewICMPLNCPRPSTP
I_CMPLNCRQMTAUTHZNFIELDSCompl. Requirement Authorization FieldsICPLRQAUTHFLDS
I_CMPLNCRQMTSTATUSCR StatusIREQSTATUS
I_CMPLNCRQMTSTATUSTEXTCR Status TextIREQSTATUSTEXT
I_CMPLRQCompliance Requirement ViewICMPLRQ
I_CMPLRQAPPLCOMPTEXTCmplRq Application Component TextICRVAPPCOMPT
I_CMPLRQDOMAINCompliance Requirement DomainICRDOMAIN
I_CMPLRQDOMAINTXTCompliance Requirement Domain TextICRDOMTXT
I_CMPLRQPATTERNCompliance Requirement PatternICOMPLRQPATTERN
I_CMPLRQVERSCompliance Requirement Version ViewICRVERSION
I_CMPLRQVERSACTIONActions relevant for compliance requirementICRVACTN
I_CMPLRQVERSACTIONTXTCompliance Requirement Version Action TextICRVACTNTXT
I_CMPLRQVERSACTVTNCR Version ActivationICRVACTVTN
I_CMPLRQVERSACTVTNCHANGEDTEXTCompliance Requirement Version ChangeICRVACTVCHNGT
I_CMPLRQVERSACTVTNCHANGEDVHCompliance Requirement Version ChangeICRVCHANGEDVH
I_CMPLRQVERSACTVTNTPCR Version ActivationICRVACTVTNTP
I_CMPLRQVERSAPPLTYAREACR Version Applicability AreaICRVAPPLTYAREA
I_CMPLRQVERSCMPLNCSTMNTCompliance Requirement - Compliance StatementICRVERSOSM
I_CMPLRQVERSCMPLNCSTMNTTXTCRV Compliance Statement TextICRVCMPLSTMNTTXT
I_CMPLRQVERSCMPLNCSTMNTVHCRV Compliance Statement Value HelpICRVCMPLSTMNTVH
I_CMPLRQVERSCNTRYCR Version CountriesICRVCNTRY
I_CMPLRQVERSCRTYPETEXTCmplRq Type TextICRVERSTYPET
I_CMPLRQVERSDESCCompliance Requirement DescriptionICOMPLRVQDESC
I_CMPLRQVERSDNGRSGDSHAZARDLBLHazard Label ViewICRVSDGHLB
I_CMPLRQVERSDNGRSGDSHAZARDMARKDangerous Goods Hazard Mark ViewICRVSDGHZM
I_CMPLRQVERSDNGRSGDSHNDLGLBLDangerous Goods Handling Label ViewICRVSDGHDL
I_CMPLRQVERSDNGRSGDSPART1ITEMCBR Basic Classification ListICRVSDGP1IT
I_CMPLRQVERSDNGRSGDSPART1ITEMTCBR Basic Classification TextsICRVSDGP1ITT
I_CMPLRQVERSDNGRSGDSSPCLPRVSNSpecial Provision ViewICRVSDGSPPR
I_CMPLRQVERSDNGRSGDSSYMBOLDangerous Goods Symbol ViewICRVSDGS
I_CMPLRQVERSDOCUMENTATIONLINKCompliance Requirement Docu LinkICMPLRQVERSURL
I_CMPLRQVERSENCLOSUREVARIANTCRV Enclosure VariantIEHFNDDREQENVAR
I_CMPLRQVERSENHANCEDCompliance Requirement Version ViewICRVERSIONENH
I_CMPLRQVERSEXEMPTIONCompliance Requirement - ExemptionsICRVERSEXM
I_CMPLRQVERSEXEMPTIONTEXTCRV Exemption TextICRVERSEXMPT
I_CMPLRQVERSEXEMPTIONVHCRV Exemption Value HelpICRVEXMPVH
I_CMPLRQVERSGRPASSGMTCompliance Req for E- and S- TablesICRVGRPASS
I_CMPLRQVERSGRPASSGMTANLYTS1Group Assignment 1 for AnalyticsICRVGRPASA1
I_CMPLRQVERSGRPASSGMTANLYTS2Group Assignment 2 for AnalyticsICRVGRPASA2
I_CMPLRQVERSLISTITMDFLTNAMERegulatory list specific primary name of listed substancesICRVRLITMDFNAME
I_CMPLRQVERSMNTRGLISTPRODNCCube Monitoring List Products AnalyticsICRVMLPRDC
I_CMPLRQVERSMNTRGLISTPRODNFACTFact Monitoring List Products AnalyticsICRVMLPRDF
I_CMPLRQVERSMNTRGLISTSLSCCube Monitoring List Sales AnalyticsICRVMLSLSC
I_CMPLRQVERSMNTRGLISTSLSFACTFact Monitoring List Sales AnalyticsICRVMLSLSF
I_CMPLRQVERSMNTRGLISTSUPLRCCube Monitoring List Supplier AnalyticsICRVMLSUPC
I_CMPLRQVERSMNTRGLISTSUPLRFACTFact for Monitoring List Raw Material AnalysisICRVMLSUPF
I_CMPLRQVERSMODEOFTRANSPORTCRV Mode of TransportIEHFNDDREQMOT
I_CMPLRQVERSPROCLVLCmplRqVers Processing Level ViewICRVERSPRLVL
I_CMPLRQVERSQUALIFGWORDPREFIXCompliance Requirement Qualifying Words PrefixICRVQUPREFIX
I_CMPLRQVERSQUALIFGWORDPREFIXTCompliance Requirement Qualifying Word Prefix TextICRVQUWPRET
I_CMPLRQVERSQUALIFGWORDSUFFIXCompliance Requirement Qualifying Words SuffixICRVQUSUFFIX
I_CMPLRQVERSQUALIFGWORDSUFFIXTCompliance Requirement Qualifying Words Suffix TextICRVQUPSUFT
I_CMPLRQVERSREGULATIONNAMECompliance Requirement Offical Regulation NameICRQVERSREGNAME
I_CMPLRQVERSREGULATIONVERSNAMECompliance Requirement Version Regulation NameICMPLRQVREGVNAME
I_CMPLRQVERSRGTYLISTDIMNDimension Monitoring ListICRVRLD
I_CMPLRQVERSRGTYLISTITEMDIMNDimension Monitoring List ItemICRVRLDI
I_CMPLRQVERSRGTYLISTITMENHCDEnhanced composite view for the items of a regulatory listICRVRLITMENH
I_CMPLRQVERSRGTYLISTITMNAMERegulatory list specific name of listed substancesICRVRLITMNAME
I_CMPLRQVERSRGTYLISTSUBSTDIMNDimension Monitoring List SubstanceICRVRLSUBD
I_CMPLRQVERSRQDDOCLANGCR Version Required Document LanguageICRVDOCLA
I_CMPLRQVERSSEGREGATIONSegregation ViewICRVSDGSEG
I_CMPLRQVERSSEGREGATIONGROUPSegregation Group ViewICRVSDGSEGGRP
I_CMPLRQVERSSEGREGATIONGROUPTCompliance Requirement Segregation Group TextCRSGRPT
I_CMPLRQVERSSGRGTNGRPFORPRODSegregation Group for ProductICRVSDGSGRPP
I_CMPLRQVERSSGRGTNGRPFORPRODTCRV Segregation Group for Product TextICRVSDGSGPT
I_CMPLRQVERSSUBSTANCELISTSubstance List ViewICRVSUBLIST
I_CMPLRQVERSSUBSTANCELISTTEXTSubstance List Text ViewICRVSUBLISTT
I_CMPLRQVERSSUBSTLISTGRPSubstance Group per Substance ListICRVLSTGRP
I_CMPLRQVERSSUBSTLISTGRPASSGMTListed Substance Group AssignmentICRVLSTGRPASS
I_CMPLRQVERSSUBSTLISTGRPSUBSTSubstance Group per Substance ListICRVLSTGRPSUB
I_CMPLRQVERSSUBSTLISTTYPETXTCRV Substsance List Type TextICRVSUBLSTTYPETX
I_CMPLRQVERSSUBSTLISTTYPEVHCRV Substsance List Type Value HelpICRVSUBLSTTYPEVH
I_CMPLRQVERSTEXTCompliance Requirement Version TextICRVERSIONT
I_CMPLRQVERSTHLDLISTITMThresholds at Listed Substances on Substance ListsICRVTHLDLISTITM
I_CMPLRQVERSTHLDLISTITMSAPThresholds at List. Subs. on Subs. Lists (SAP Content Only)ICRVTHLDLISTITMS
I_DNGRSGDSCLASSFCTNCODETEXTClassification Code TextIDGCCTXT
I_DNGRSGDSCLASSTEXTClass or Devision TextIDGCLTXT
I_DNGRSGDSEUADRCLASSTEXTEU ADR Class TextIDGEUADRCLTXT
I_DNGRSGDSHANDLINGLABELTEXTHandling LabelIDGHDLBT
I_DNGRSGDSHAZARDIDNNMBRTEXTHazard Identification Number TextIDGHIDNTXT
I_DNGRSGDSHAZARDLABELTEXTHazard LabelIDGHLT
I_DNGRSGDSHAZARDMARKTEXTHazard MarkIDGHZMT
I_DNGRSGDSMARINEPOLLUTANTTEXTMarine Pollutant TextICRVDGSMPOLTXT
I_DNGRSGDSMODEOFTRANSPTGRPMAPMode of Transport Group Mapping to Modes of TransportsIDGMOTGMAP
I_DNGRSGDSSEGREGATIONCODETEXTSegregation Code Text ViewICRVDGSSEGCDTXT
I_DNGRSGDSSEGREGATIONGROUPTEXTSegregation Group Text ViewICRVSDGSEGGRPTXT
I_DNGRSGDSSPECIALPROVISIONTEXTDangerous Goods Special Provision TextIDGSPTXT
I_DNGRSGOODSMODEOFTRANSPORTDangerous Goods Mode of Transport codeIDGMOT
I_DNGRSGOODSMODEOFTRANSPORTGRPDangerous Goods Mode of Transport GroupsIDGMOTGRP
I_DNGRSGOODSMODEOFTRANSPORTTXTDangerous Goods Mode of Transport TextIDGMOTT
I_EHSCMPLNCRQMTIDHEXCompliance Requirement Version Hex UUIDICREQIDHEX
I_EHSCMPLRQIMPRTCITATIONCNTExternal Content Regulations CountIEHSREQEXTCCNT
I_EHSCMPLRQIMPRTCITATIONCNTDExternal Content Regulations CountIEHSREQEXTCCNTD
I_EHSCMPLRQIMPRTEXTCMPLRQCNTExternal Content Regulations CountIEHSREQEXTRCNT
I_EHSCMPLRQIMPRTEXTREGULATIONSBasic View for Compliance IntegrationIEHSCREQEXTREG
I_EHSCMPLRQIMPRTEXTUPDATEBasic View for Compl Integration UpdateIEHSCREQEXTUPD
I_ENCLOSUREVARIANTEnclusure Variant codeIENCLOSUREVAR
I_ENCLOSUREVARIANTTEXTEnclosure Variant TextIENCLOSUREVART
I_LISTEDSUBSTANCEListed Substance ViewILISUROOT
I_LISTEDSUBSTANCECNDNTEXTListed Substance Condition Text ViewILISUCONDT
I_LISTEDSUBSTANCECUSTListed Substances provided by CustomerILISUCUS
I_LISTEDSUBSTANCEDEFAULTNAMEListed Substance Default NameILISUDEFNAM
I_LISTEDSUBSTANCEDEFNAMEListed Substance Default NamesILISUDEFNAME
I_LISTEDSUBSTANCEDEFNAMECUSTDefault Name in All Languages for Customer LiSuILISUDEFCUS
I_LISTEDSUBSTANCEDEFNAMESAPDefault Name in All Languages for SAP LiSuILISUDEFSAP
I_LISTEDSUBSTANCEGROUPListed Substance Group ViewILISUGROUP
I_LISTEDSUBSTANCENAMETEXTListed Substance Text ViewILISUNAMET
I_LISTEDSUBSTANCENAMETEXTSAPListed Substance Text View (SAP Content Only)ILISUNAMETSAP
I_LISTEDSUBSTANCESAPListed Substances provided by SAPILISUSAP
I_LISTEDSUBSTANCESTDVHListed Substance ViewILS__VH
I_LISTEDSUBSTANCEVARIANTListed Substance Variant ViewILISUVAR
I_LSTDSUBSTPRIMNAMETXTListed Substance Primary Name ViewISUBLISURINAMT
I_LSTDSUBSTWTHVARANDGRPListed Substance ViewILISU
I_PRODCMPLNCPHRSPhraseIPCPHRS
I_PRODCMPLNCPHRSCONTEXTContext of a PhraseIPCPHRSCONTEXT
I_PRODCMPLNCPHRSCONTEXTTEXTText for Context of a PhraseIPCPHRSCTXT
I_PRODCMPLNCPHRSENABLEDFIELDPhrase-enabled FieldIPCPHRSFLD
I_PRODCMPLNCPHRSENBLDFLDRPSTRYRepository of Phrase-enabled FieldIPCPHRSFLDRPSTRY
I_PRODCMPLNCPHRSTEXTPhrase TextIPCPHRSTXT
I_PRODCMPLNCPHRSTXTWTHFALLBACKText for every Phrase in every LanguageIPHRSTXTFB
I_SUBSTANCENAMEONLISTSubstance Name on List ViewISUBSTNAMLIST
I_SUBSTANCENAMEONLISTSAPSubstance Name on List View (SAP Content Only)ISUBSTNAMLISTSAP
P_CMPLNCRQMTCURFUTREVISIONCompliance Requirement Current or First Future RevisionPCMPLCURFUTREV
P_CMPLNCRQMTLASTPASTREVCompliance Requirement Last Past RevisionPCMPLNCPASTREV
P_CMPLNCRQMTNEWESTREVNewest Compliance Requirement RevisionPCMPLNCRQNR
P_CMPLNCRQMTRELEVANTREVCompliance Requirement Relevant RevisionPCMPLNCRELREV
P_CMPLRQCONTENTPROVIDER_VHCompliance Requirement Pattern UnionPCOMPLRQCNTPRVD
P_CMPLRQPATTERNCompliance Requirement Pattern UnionPCOMPLRQPATTERN
P_CMPLRQVERSACTIONCOUNTCounts Exemptions per CmplRqVersPCRVACTNCOUNT
P_CMPLRQVERSACTVTNCMPLRQUSAGECounts the usage of the Requirement in other objectsPCRVACTVCRUSE
P_CMPLRQVERSACTVTNDYNVALUESDynamic Values for Compliance Requirement ActivationPCRVACTVDYNVAL
P_CMPLRQVERSCMPLNCSTMNTCOUNTCounts Compliance Statements per CmplRqVersPCRVOSMCOUNT
P_CMPLRQVERSCONSTANTSUnpackaged Product Market Requests Unprocessed/CoveredPCRVCONST
P_CMPLRQVERSDNGRSGDSPRT1ITMCRV Dangerous Goods Part 1 Item ListPCRVDGPRT1ITMLST
P_CMPLRQVERSDNGRSGDSPRT1ITMTXTCompliance Requirement Version Dngrs Gds Part 1 Item TextPCRVDGPRT1ITMTXT
P_CMPLRQVERSEXEMPTIONCOUNTCounts Exemptions per CmplRqVersPCRVEXMCOUNT
P_CMPLRQVERSLISTGRPASSGMTUNIONListed Substance Group AssignmentICRVLSTGRPASSU
P_CMPLRQVERSLISTTYPECOUNTCounts Lists per CmplRqVers and ListTypePCRVREGLTYPECNT
P_CMPLRQVERSPREDECESSORCOUNTNumber of Predecessor CRVs per CRVPCRVPREDCRV
P_CMPLRQVERSSINGLEACTIONCounts Exemptions per CmplRqVersPCRVSINGLEACTN
P_CMPLRQVERSTHLDLISTITMDTLSDetails of Threshold based Substance ListsPCRVTHLDLSTITDT
P_CMPLRQVERSUNIONEXPOSURELIMITCompliance Requirement Union for E- and S- TablesPCRVUNIONEXPLMT
P_CMPLRQVERSUNIONGRPASSGMTCompliance Requirement Union for E- and S- TablesPCRVUNIONGRPASS
P_CMPLRQVERSUNIONNAMEONLISTCompliance Requirement Union for E- and S- TablesPCRVUNIONNAMELST
P_CMPLRQVERSUNIONTHRESHOLDLISTCompliance Requirement Union for E- and S- TablesPCRVUNIONTHRLST
P_CMPLRQVERSVHCRV Value HelpPCMPLRQVERSVH
P_COMPLIANCEREQUIREMENT_VHCompliance Requirement Pattern UnionPCOMPLRQVH
P_LSTDSUBSTETABLEGRPRListed Substance Direct Access to ETablePLISUETGR
P_LSTDSUBSTETABLENAMEListed Substance Direct Access to ETablePLISUETNM
P_LSTDSUBSTETABLEROOTListed Substance Direct Access to ETablePLISUETRT
P_LSTDSUBSTPRIMNAMEKEYListed Substance Name minimal Sequence determinationPSUBLISUPNAMKEY
P_LSTDSUBSTUNIONGRPRListed Subs Union for E- and S-TablePLISUUNGR
P_LSTDSUBSTUNIONNAMEListed Subs Union for E- and S-TablePLISUUNNM
P_LSTDSUBSTUNIONROOTListed Subs Union for E- and S-TablePLISUUNRT
P_NAMEONLISTFALLBACKALLLANGSAPName on List Fallback at SAP Content (All Languages)PNAMONLSTFBALS
P_NAMEONLISTFALLBACKINTERNALInternal View for Name on List FallbackPNAMONLSTFBINT
P_NAMEONLISTFALLBACKSAPName on List Fallback for Substances and SAP ContentPNAMONLSTFBSAP
P_NEWESTCMPLRQVERSThe newest version of a compliance requirementPNWSTCMPLRQVERS
P_PROPERSHIPGNAMEFALLBACKSCORELanguage Fallback Score for Proper Shipping NamePPRPSHPNFBSCORE
P_PROPERSHIPGNAMEMAXFBSCORELanguage Fallback Max Score for Proper Shipping NamePPRPSHPNMFBSCORE
P_PRPSNMBROFASSGDCHMLCMPLNCNumber of CCIs assigned to the purposePCPNRACCI
R_PRODCMPLNCPHRSENABLEDFIELDTPTP-View for Phrase Enabled FieldsRPCPHRSFLDTP
R_PRODCMPLNCPHRSTEXTTPTP-View for Phrase TextRPCPHRSTEXTTP
R_PRODCMPLNCPHRSTPTP-View for PhraseRPCPHRSTP