CDS Views for SAP Agricultural Contract Management (LO-AGR)

CDS View NameDescriptionSQL View Name
C_ACMCONTRACTBUSINESSPARTNERVHValue Help for Business PartnerCPARTNERVH
C_ACMCONTRACTSNAPSHOTACM Trading Contract SnapshotCACMCNTRCTSNP
C_ACMCONTRACTTRADERIDVALUEHELPConsumption View for Contract Trader ID Value HelpCTRADERIDVH
C_ACMCONTRPRCMETHODMASTERDATAPricing Method Master DataCTCPRCRMETMAS
C_ACMCONTRTOLERANCEHEADERDETSConsumption View for Tolerance HeaderCQTOLHDRDETL
C_ACMCONTRTOLERANCEITEMDETSContractItem Tolerance Detls ConsumptionCTOLITMDETLS
C_ACMMAINTAINCONTROVWSTSTCConsumption View for Maintain Contract StatisticsCACMMNTNCONTSTAT
C_ACMMNTNCONTRACTSNAPSHOTTrading Contract Snapshot DetailsCACMCNTRCTSNAP
C_ACMMNTNPRCGCOMPONENTDATAPricing component data listCMNTNPRCGCOMP
C_ACMMNTNPRCGLOTCMMDTYORDERConsumption for Price Lot Commodity OrderCPLOTCDOTE
C_ACMMNTNPRCGLOTFEEDETOVWPricing Lot Fee Details OverviewCPRCNGLOTFEEDET
C_ACMMNTNPRCGNOMINATIONDETNomination Details for Price LotsCACMPRCGNOM
C_ACMMNTNPRCLOTPRCMETHDETConsumption for Price Lot Pricing method detailsCPRCNGPLOTMETH
C_ACMMNTNTRADINGCONTRACTOVWConsumption View for Maintain Trading Contract OverviewCMNTNTRDGCTROVW
C_ACMMNTNTRDGCONTRPRCGOVWCnsmpn view for Mntn Trdg Contr Prc OvwCMNTNCONTPRCGOVW
C_ACMPRCRECONCILIATIONRPTQRYPrices Reconciliation ReportCPRCRECONREPQRY
C_ACMQTYRECONCILIATIONRPTQRYQuantity Reconciliation ReportCQTYRECONREPQRY
C_ACMSNAPSHOTPROCESSINGSTSVHValue Help for Output Processing StatusCSNPOPRSTSVH
C_ACMTRADINGCONTRACTFEESOVWConsumption View for Trdg Contract FeesCACMTRDCONTFEE
C_ACMTRADINGCONTRACTHDRFEEDETConsumption View for Contract Header FeeCACMCONTHDRFEE
C_ACMTRADINGCONTRACTITEMFEEDETConsumption View for Contract Item FeeCACMCONTITEMFEE
C_ACMTRADINGCONTRACTITEMFEESConsumption View for Contract Item FeesCACMTRDITEMFEE
C_ACMTRADINGCONTRACTITEMOVWConsumption View for Contract Item OvwCACMCONTRITEM
C_ACMTRADINGCONTRACTSNAPSHOTACM Trading Contract SnapshotCACMTRDCNTRCTSNP
C_ACMTRDGCONTRACTPRICELOTFEESConsumption View for Contract PL FeesCACMCONTPLFEE
C_ACMTRDGCONTRDYNQTYDETSQUERYConsumption Query- Trdg Contr Qty DetailCTRCDYNQTYDETQRY
C_ACMTRDGCONTRHDRPARTDETAILSConsumption view for Trading Contract Header Partner detailsCTRDGCONTRPARTDT
C_ACMTRDGCONTRITEMFREECHARCSContract Item Free Characteristics ConsumptionVCITMFREECHARS
C_ACMTRDGCONTRITMCANCEVENTDETSConsumption View Item Cancel Event DetsCITMCANCEVENTDET
C_ACMTRDGCONTRITMCANCEVENTINFOConsumption View Item Cancel Event InfoCATCITMCANCEVENT
C_ACMTRDGCONTRITMRELATEDTRADESConsumption View Item Related TradesCATCITMRELTRD
C_ACMTRDGCONTRPRCFIXATIONDETPrice Fixation Details Consumption ViewCTRDGCTRPRCDT
C_ACMTRDGCONTRPRCGLOTFEEDETAILConsumption View Contract Price Lot FeeCACMCONTPLOTFEE
C_CMMDTYBEGPOSPNLVALUEQRYCommodity BP PnL ValueCCMMBPPNLVALUEQ
C_CMMDTYMTMSTKENDOFDAYQRYMtM End-of-Day Values Query for StockCCMMMTMSTKEODQRY
C_CONTRACTAPPLICATIONSTATUSVHValue Help for Cntrct Application StatusCCNTRCTAPPSTVH
C_CONTRACTSNAPSHOTLEVELVHContract Snapshot LevelCSNPLVLVH
C_CONTRACTSNAPSHOTVHValue Help for Contract SnapshotCCNTRCTSNPIDVH
C_CONTRACTSNPSHTSIGNRELVHConsumption for Snapshot Signature RelevanceCSNPSGNRLVH
C_CONTRMTMLOGCURQRYContract MtM Logisitic Current Value QueryCACMMTMLOGCUR
C_CONTRMTMLOGDAYOVERDAYQRYContract MtM Logisitic DOD Value QueryCACMMTMLOGDOD
C_CONTRMTMLOGENDOFDAYQRYContract MtM Logisitic EOD Value QueryCACMMTMLOGEOD
C_CONTRNETBEGPOSPNLVALQRYNet Beg Position PnLVal QryCNETBPPNLVALUEQ
C_MAINTAINCONTRCOUNTERPARTYVHConsumption View for Counter Party Details with Org DataCMNTNCONTCNTPTVH
C_NETPOSITIONRISKREPORTConsumption view for Net Position Risk ReportCNETPOSREPT
C_NETPOSREPPREMIUMACM Position Report PremiumCNETPOSREPPR
C_NETPOSREPPREMIUMDAYOVERDAYACM Position Report Premium - DoDCNETPSOREPPRDOD
C_NETPOSREPPREMIUMENDOFDAYACM Position Report Premium - EoDCNETPOSREPPREOD
C_NETPOSREPPRICEACM Position Report Price TypeCNETPOSREPPT
C_NETPOSREPPRICEDAYOVERDAYACM Position Report Price Type - DoDCNETPOSREPPTDOD
C_NETPOSREPPRICEENDOFDAYACM Position Report Price Type - EODCNETPOSREPPTEOD
C_NETPOSREPSLATEACM Position Report SlateCNETPOSREPSL
C_NETPOSREPSLATEDAYOVERDAYACM Position Report Slate - DoDCNETPOSREPSLDOD
C_NETPOSREPSLATEENDOFDAYACM Position Report Slate - EODCNETPOSREPSLEOD
C_NETPOSRISKREPORTDAYOVERDAYConsumption Query For Net Position Risk Report Day Over DayCNETPOSRISKDOD
C_NETPOSRISKREPORTENDOFDAYConsumption Query for Net Position Risk Report End of DayCNETPOSRISKEOD
C_PNLDELTANEWACTIVITYVALACM Cmdty PnL Value New activityCACMPNLDNAVAL
C_PNLNEWACTIVITYVALACM Cmdty PnL Value New activityCACMPNLNAVAL
C_POSREPPREMIUMACM Position Report PremiumCPOSREPPR
C_POSREPPREMIUMDAYOVERDAYACM Position Report Premium - DoDCPSOREPPRDOD
C_POSREPPREMIUMENDOFDAYACM Position Report Premium - EoDCPOSREPPREOD
C_POSREPPRICEACM Position Report Price TypeCPOSREPPT
C_POSREPPRICEDAYOVERDAYACM Position Report Price Type - DoDCPOSREPPTDOD
C_POSREPPRICEENDOFDAYACM Position Report Price Type - EODCPOSREPPTEOD
C_POSREPSLATEACM Position Report SlateCPOSREPSL
C_POSREPSLATEDAYOVERDAYACM Position Report Slate - DoDCPOSREPSLDOD
C_POSREPSLATEENDOFDAYACM Position Report Slate - EODCPOSREPSLEOD
C_PREPAYMENTAGREEMENTREQUESTPrepayment Request Tab Contract AppCACPPMGPART
C_PREPAYMENTAGRMTLINKHISTORYLinkage history of prepaymentsCPPMTLINKAGE
C_PREPAYMENTCONTRACTLINKEDList of linked Prepayment agreementsCPPMTCON
C_PREPAYTHRESHOLDPERCENTConsumption view for thresholdCPPMTTHOLD
C_SNAPSHOTSIGNATURESTATUSVHF4 Help for Snapshot Signature StatusCSNPSIGSTVH
C_STKMTMWITHQLTYCHARCSCnsmpn View Stock MtM with Qlty charcsCACMSTKMTMQLTY
C_TRDGCONTRSNPSHTSTATISTICTrading Contract Snapshot Status StaticsCCONTRSNAPSTAT
C_TRDGCONTRSTATUSSTATISTICSACM Trading Contract Status StatisticsCTRDGCONTRSTATS
E_APPLICATIONDOCUMENTExtension View for /ACCGO/T_APPDATAEACMAPPDOCDATA
E_APPLICATIONDOCUMENTITEMExtension for Application Item DataEACMAPPLITEM
E_CONTRACTITEMExtension for Contract Item DataEACMCONTRITEM
E_SETTLMTDOCExtension View for Settlement Unit HeadEACMSTLUNITHDR
I_ACMAPPLASSGMTQTYLATESTDISTRACM Appl Assignment Qty DistributionIAPPQTYDIS
I_ACMAPPLASSIGNMENTQTYDISTRAppl Assignment Quantity DIstributionIAPPLQTYDISTR
I_ACMAPPLBUSDATABATCHSPLITCORRApplication Business DataIACMBUSBSPLIT
I_ACMAPPLICATIONLATESTVERSIONLatest version of all application GUIDsIACMAPLATVERS
I_ACMAPPLITEMBATCHSPLITCORRApplication details for batch splitIACMAPPBSPLTCOR
I_ACMAPPLNOMINATIONINFOInterface view for Appl Nom InfoIAPPNOMINFO
I_ACMAUTHZNDATAFORACTIVITYGRPInterface view for Authorization Data for Activity GroupIACMAUTHACTVTGRP
I_ACMBUYERSELLEROPTIONVHTolerance Buyer Seller Value HelpBUYERSELLER
I_ACMCMMDTYVALUEHELPInterface view for Cmmdty Value HelpICMMDTYVALHELP
I_ACMCOMMODITYCONTRACTCANCLNView on Commodity Contract Cancellation InformationICMMDTYCONTRCANC
I_ACMCOMMODITYDETAILSInterface for Commodity DetailsIACMCOMDET
I_ACMCOMMODITYORDERREQUESTTPCommodity Order Request dataIACMCMDTORDREQTP
I_ACMCONSUMPTIONRULEVHConsumption Rule Value HelpICONSRULEVH
I_ACMCONTRACTADMINDETTrading Contract Administration DetailICNTRCTSNPADM
I_ACMCONTRACTADMINDETVALInterface view for Trading Contract Administration DetailICNTRCTSNPADMVAL
I_ACMCONTRACTAPPLSTATUSContract Application StatusIACMCAPSTS
I_ACMCONTRACTCOMMODITYSUBITEMBaisc View on Trading Contract: commodity sub itemsICMMDTYSUBITM
I_ACMCONTRACTCOUNTERPARTYInterface for Contract CounterpartySQL_VIEW_NAME
I_ACMCONTRACTCUSTOMERREFCustomer Reference for ContractIACMCNTCUSTREF
I_ACMCONTRACTHEADADDLDATAACM Contract Header (WBHK Additional Data) - /ACCGO/T_CAKHDRACMCONTHEADADD
I_ACMCONTRACTHEADERContract HeaderITRDGCTRHEAD
I_ACMCONTRACTITEMADDLDATABasic View on ACM Contract Item (WBHI Additional Data)ICONTRITMADDL
I_ACMCONTRACTOPTIONBasic View on Contract OptionalityICONTROPTN
I_ACMCONTRACTOPTIONVALUETYPEVHValue Help for Optionality Value TypeIOPTNVALUETYPEVH
I_ACMCONTRACTPARTNERFUNCTIONVHValue Help for Partner FunctionPPARTNERFUNCVH
I_ACMCONTRACTPRCBRIDGEDETAILSBasic View For CPE To Pricing Aspect Bridge DetailsIACMCPEBRIDGEDET
I_ACMCONTRACTPRICINGASPECTDATAInterface View for Trading Contract Pricing aspect dataIACMCONTPRCASPCT
I_ACMCONTRACTRELTDTRDSTATUSVHValue Help for Related Trade StatusIRELTRDSTATUSVH
I_ACMCONTRACTSNAPSHOTADDLDETACM Contract Snapshot Addl Admin DetICNTRCTSNPADDET
I_ACMCONTRACTSTATUSCATEGORYContract Status CategoryICAKSTATCAT
I_ACMCONTRACTSUBITEMDETTrading Contrct Sub item detailsICONTRACTSUBITEM
I_ACMCONTRACTTRADERIDTEXTContract Trader ID TextIACMTRDRIDTXT
I_ACMCONTRACTTRADERIDVHValue help for Trader IDPTRADERIDVH
I_ACMCONTRACTTRADERVALUEHELPInterface for Contract Trader IDICNTRTRDRVH
I_ACMCONTRACTTYPEWITHSIDEInterface view for Contract Type with respect to sideICNTRWTHSIDE
I_ACMCONTRACTUSERTRADERIDGet Contract User Trader IdIUSERTRDRID
I_ACMCONTRADDLSNPSHTDETSContract Header with Additonal Admin FieldsICNRCTSNPADDETS
I_ACMCONTRITEMACTVSETTLMTDETSACM Contract Active Settlement detailsISTLACTVDETS
I_ACMCONTRITMRELATEDTRADESItem Related Trades ViewIACMITRELTRD
I_ACMCONTRNOMINATIONLOTINFOInterface view for Contr Nom Lot InfoICONTNOMLOTINFO
I_ACMCONTRNONPRCDTMPLOTDETSContract temporary NPE lot detailsINONPRCTMPLOTDET
I_ACMCONTROPTIONSCROPSEASONIDInterface View for Contract Optionality Crop Session IdICONTRCRPSESNID
I_ACMCONTROPTIONSMNSOFTRANSPVHInterface View for Contract Optionality Means of TransportICONTOPTMNSOTRNS
I_ACMCONTROPTNCATEGORYIDVHACM Contract Optionality Category IDICNTROPNLCTGIDVH
I_ACMCONTRPRCFIXATIONLOTDETFix Lot Details combine for Fut, B & SBICONTPRFIXLOTDET
I_ACMCONTRPRCGOVWFORMAINTCONTRPricing Details of Trading Contract Maintain Contract AppITCPRCOVMNTCONT
I_ACMCONTRPRCMETHODMASTERDATAMaster data for Pricing MethodsITCPRCRMETMAS
I_ACMCONTRSNAPSHOTADDLFIELDSACM Contract Snapshot Addition FieldsICNTRCTSNPADFLD
I_ACMCONTRSNAPSHOTCONTRDOCTrading Contract Snapshot DocumentICNTRCTSNPDOC
I_ACMCONTRSNPSHTADDLVALVHSnapshot Additional Details Value HelpISNPSHTADVLVH
I_ACMCONTRSNPSHTADDLVHInterface view for Snapshot Additional Details Value HelpISNPSHTADDVH
I_ACMCONTRSNPSHTADMINFIELDVHSnapshot Administration Field ValueHelpISNPSHTADMVH
I_ACMCONTRSNPSHTFILTERVHInterface view for Snapshot Additional Details Value HelpISNPSHTFILVH
I_ACMCONTRSNPSHTHEADITMDETContract Snapshot Header Item DetailsISNPSHTHDITM
I_ACMCONTRTOLERANCEHEADERDETSInterface Layer for Contract Item Tolerance HeaderITQTOLHDRDETLS
I_ACMCONTRTOLERANCEHEADERINFOInterface Layer for Tolerance HeaderITTOLREANCEHDR
I_ACMCONTRTOLERANCEITEMDETSContractItem Tolerance Details InterfaceITOLITEMDETLS
I_ACMCONTRTOLERANCEITEMINFOContract Item Tolerance InformationITOLERANCEITM
I_ACMCRDTTYPEOFASSIGNVHCredit Sales Type Of Assign Value HelpTYPEOFASSIGN
I_ACMCUSTOMERCOUNTERPARTYInterface for Customer counter partyIACMCUSTCPTY
I_ACMDETDEFAULTCONTRACTTYPEInterface view for determining default contract typeIDETCNTRTYPE
I_ACMDFLTDOMAINFORPRPSInterface Layer for user detailsIDFTDMPUR
I_ACMDISCPREMQLTYSCHEDACTNCODEValue Help for Action CodeIACTNCODEVH
I_ACMDISCPREMQLTYSCHEDAPPLTOVHValue Help for Applies To CodeIAPPLIESTOVH
I_ACMDISCPREMQLTYSCHEDCALCMETHValue Help for Calculation Method CodeICALCMETHCODEVH
I_ACMDISCPREMQLTYSCHEDCHRGTYPEValue Help for Charge TypeICHRGTYPEVH
I_ACMDISCPREMQLTYSCHEDGOVANLYSValue Help for DPQS Governing AnalysisPGOVANLY
I_ACMDISCPREMQLTYSCHEDGOVWGTVHGoverning Weight Code Search HelpGOVWGTCD
I_ACMDISCPREMQLTYSCHEDQTYTYPEValue Help for Quantity TypeIQTYTYPEVH
I_ACMDISCPREMQLTYSCHEDRATETYPEValue Help for Rate TypeIRATETYPEVH
I_ACMDISCPREMQLTYSCHEDRNDNGDIRValue Help for Rounding DirectionIRNDNGDIRECVH
I_ACMDISCPREMQLTYSCHEDTIMINGVHDPQS Timing Value HelpDPQSTIME
I_ACMDISCPREMQTYOVRDGOVTERMVHDiscount Premium Quantity Override Governing TermIDPQSGOVTRMVH
I_ACMDISTRIBUTIONCHNLVALUEHELPList Of Distribution ChannelIACMDISTCNLVH
I_ACMFEEMASTERDATAFee Master DataIACMFEEMASTDATA
I_ACMFEENAMEVHInterface View For Fee Name Value HelpIACMFEENAMEVH
I_ACMFEETYPEVHInterface View For Fee Type Value HelpIACMFEETYPEVHELP
I_ACMFORMULAGRPGGENERALRESCPE Formula Grouping and General ResultIFMLAGRPGENRS
I_ACMFORMULAGRPGGENERALRESULTCPE Formula Grouping and General ResultIFMLAGRPGENRSLT1
I_ACMGOVERNINGREGIONCODEVHGoverning Region Code Value HelpGOVREGIONC
I_ACMINTENDEDPRICETYPEVHIntended price type value helpIINTPRCTYPVH
I_ACMLISTEDOPTIONSDCSDerivative Contract Specification for Listed Options,FuturesIACMLSTDOPTNDC
I_ACMLOGISTICALLYADJDAPPLQTYACM Trading Contract LAQILAQAPPLQTY
I_ACMMAINTAINCONTROVWSTSTCInterface view for Maintain Contract StatisticsIACMMNTNCONTST
I_ACMMAINTAINTRDGCONTOVWSTSTCInterface view for Maintain Contract StatisticsICONTROVWSTAT
I_ACMMAPDOCITEMDATACPE Caller Mapping KNUMV and Document Item to GUIDIMAPGDOCDATA
I_ACMMAPPINGDOCITEMDATACPE Caller Mapping KNUMV and Document Item to GUIDIMAPPGDOCITM
I_ACMMATERIALUNITCNVRSNFACTORBasic View for Material Unit Of MeasureIACMMATUOM
I_ACMMATERIALVALUETEXTInterface for Material DescriptionIACMMATTEXT
I_ACMMNTNCONTRSIDETEXTInterface for Contract Side DescriptionIACMCTRSIDETXT
I_ACMMNTNPRCGGRPANDFORMULADETCPE group and formula detailsIACMPRCGCPED
I_ACMMNTNPRCGLOTCMMDTYORDERInterface Layer Trading Contract Price Fix CDote DetailsIMNTNPRCCOMORD
I_ACMMNTNPRCGNOMINATIONHDRDETNomination Header Details ListIACMPRCGNOMHD
I_ACMMNTNTRADINGCONTRACTOVWInterface View for maintaining for Trading Ctr OverviewIMNTNTRDGCTROVW
I_ACMMNTNTRDGCONTRPRCGASPECTInterface View for Maintain Trading Contract Pricing AspectIMNTNTCPRCASPDET
I_ACMMNTNTRDGCONTRPRCGOVWIntrfce view for Mntn Trdg Contr Prc OvwIMNTNCONTPRCGOVW
I_ACMNOMINATIONITMDETInterface View for Nom Item DetailsINOMITMDET
I_ACMNOMINATIONVALUEHELPInterface view for Nomination Value HelpINOMVALUEHELP
I_ACMNONPRICEDCONDITIONDETAILSCondition Details for Non Priced entry in Trading ContractINONPRCDCONDDETS
I_ACMOBLIGATIONSTORLOCATIONBasic View for Obligation Storage LocationIACMOBLGSTRGLOC
I_ACMOPTNCATIDContract Optionality Category IDIACMCNTOPTID
I_ACMOPTNSOURCELOCVHValue Help for Option Souce LocationIOPTIONSOCLOCCVH
I_ACMOPTNTYPEVHValue Help for Optionality TypeIOPTNTYPEVH
I_ACMORGLELEMENTSFORAUTHZNInterface view for Organizational elements for authorizationIACMORGELMFRAUTH
I_ACMPRCFIXATIONEXERDATAIntrface view for Prc Fixation Exer DataIPRCFIXEXERDATA
I_ACMPRCGCNVRSNINPUTInterface View for Prcg Conversion InputIPRCGCONVINPUT
I_ACMPRCGCNVRSNRESULTInterface View for Prcg Conversn ResultIPRCGCONVRESULT
I_ACMPRCGDETAILSFORMNTNCONTRPrice Fixation Details for Maintain Contract FIORI AppIACMPRCMNTNCONTR
I_ACMPRCGFIXATIONFORMNTNCONTRPrice Fixation Details for Maintain Contract FIORI AppIPRCGFXTONMNTCNT
I_ACMPRCGMETHODVALUEHELPInterface view for Prcg Method Val HelpIPRCGMETHVALHELP
I_ACMPRCRECONCILIATIONRPTCUBEPrice Reconciliation Report CubeIPRCRECONREPCUBE
I_ACMPRCRECONCILIATIONRPTEXTNPrice Reconciliation Report ExtentionIPRCRECONREPEXTN
I_ACMPREMIUMDISCOUNTTYPEVHValue Help for Premium Discount TypePPREMDISCTYPVH
I_ACMPRICEFIXATIONSTATUSDomain view for Price Fixation StatusIPRCFIXNSTS
I_ACMPRICEFIXATIONSTATUSTEXTText view for Price Fixation StatusIPRCFXNSTSTXT
I_ACMPRICINGCALCULATIONGROUPPricing Calculation GroupIACMPRCCALCGRP
I_ACMPRICINGELEMENTPricing ElementIACMPRCELEMENT
I_ACMPRICINGEXTENSIONDATAInterface View for Pricing Extension DataICPEDEXTENSION
I_ACMPRICINGTYPEVHIntended Price Type Value HelpPRICETYP
I_ACMPRTYPEVHIntended Price Type Value HelpPRICETYPE
I_ACMQTYRECONCILIATIONRPTCUBEQuantity Reconciliation Report CubeIQTYRECONREPCUBE
I_ACMQTYRECONCILIATIONRPTEXTNQuantity Reconciliation Report ExtentionIQTYRECONREPEXTN
I_ACMRECNCLNCNVRSNDUSTTHLDVALUnit conversion dust threshold valuesIACMRECCONVTHR
I_ACMRECONCILIATIONRECORDTYPEReconcilation Record Domain ViewIRECONRECTYPE
I_ACMRECONCILIATIONRECTYPETEXTReconciliation Record Type TextIRECONRECTYTXT
I_ACMREPLACEMENTPRICETYPEVHReplacement Price Type Value HelpIREPPRCTYPVH
I_ACMRLVTPURCHASETYPEACM Cas Relevant Purchase documentIACMCASPURTY
I_ACMROLEASSIGNMENTFORUSERInterface layer for role assigned to the userIACMUSRROLASGNT
I_ACMSETAPPLICATIONDETAILSLayer for application detailsIACMSETAPDET
I_ACMSETAPPLICATIONDOCITEMCA Application document itemIACMSETAPDIT
I_ACMSETTLEMENTLATESTCREATIONSettlement Unit Latest based on CreationIACMSTLDLCRT
I_ACMSNAPSHOTPROCESSINGSTSTXTSnapshot Output Processing Status TextISNPOPRSTTEXT
I_ACMSNAPSHOTPROCESSINGSTSVHSnapsht Output Processing Status Val HlpISNPOPRSTSVH
I_ACMTERMCONVERSIONBasic View for CPE Term Input for ConversionICPEDTERMCONV
I_ACMTOLBUYRSLROPTIONVHBuyer Seller Search HelpPBUYERSELLER
I_ACMTOLERANCEDIRECTIONVHTolerance Direction Value HelpPTOLDIRECTIONVH
I_ACMTOLERANCELIMITVHTolerance Limit Higher or LowerPTOLLIMITVH
I_ACMTOLERANCEPRICEAPPLVHTolerance Price Application Value HelpPTOLPRICEAPPLVH
I_ACMTOLERANCESCHEDULEDETSInterface Layer for Tol Schedule DetailsITOLESCHEDDETS
I_ACMTOLERANCESCHEDULEVHTolerance ScheduleTOLSID
I_ACMTOLERANCETYPEVHValue Help for Tolerance TypeTOLTYPEVH
I_ACMTOLPRAPPVHPrice Application Flat or TieredPRAPPL
I_ACMTRADEOFFICEInterface for Trade OfficeIACMTRDOFC
I_ACMTRADEOFFICEVALUEHELPTrade Office Value HelpITRADEOFFICE
I_ACMTRADINGCONTRACTDETAILSInterface view for Trading Contract DetailsITRDGCONTRCTDTLS
I_ACMTRADINGCONTRACTFEESOVWInterface Layer for Contract FeesIACMTRDCONTFEE
I_ACMTRADINGCONTRACTHDRFEEDATAInterface Layer for Contr Hdr Fee DataIACMHDRFEEDATA
I_ACMTRADINGCONTRACTHDRFEEDETInterface View for Contract Header FeesIACMCONTHDRFEE
I_ACMTRADINGCONTRACTITEMDATABasic View on Contract ItemITRDGCONTRITM1
I_ACMTRADINGCONTRACTITEMFEEDETTrading Contract Item Fee DetailsIACMCONTITEMFEE
I_ACMTRADINGCONTRACTITEMFEESInterface View for Item Fees DataIACMTRDITMTFEE
I_ACMTRADINGCONTRACTITEMOVWInterface for Contract Item OverviewITRDGCONTRITM
I_ACMTRADINGCONTRACTPRICINGOVWIntrface View for Trdg Cont Prcg DetailsIACMTCPRCOVW
I_ACMTRADINGCONTRACTSUBITEMTrading Contract: commodity sub itemsIACMCMMDTYSUBITM
I_ACMTRADINGCONTRACTTRADERACM Trading Contract Trader InformationITRDGCONTRTRADER
I_ACMTRADINGCONTRACTTYPEView for ACM Trading Contract StatusACMTRDGCTRTYPE
I_ACMTRANSCTPTYPRFIXATIONSView For Transacting Counter Party Partner FunctionsIACMCONTTCPPF
I_ACMTRDGCNTRPRCBRIDGEDETSInterface Layer for Bridge DetailsIPRCGCASPBRDGE
I_ACMTRDGCONTRACTBUSINESSDATABasic View on Trading Contract Business DataITRDGCONTRBUS1
I_ACMTRDGCONTRACTITEMDETAILSInterface view for Trading Contract Item DetailsIACMTCITMDTLS
I_ACMTRDGCONTRACTPARTNERDETSInterface view for Trading Contract Partner detailsITRDGCONTRPART
I_ACMTRDGCONTRACTPRICELOTFEESInterface Layer for Contract PL FeesIACMTRDPLFEE
I_ACMTRDGCONTRACTSTATISTICSTrading Contract Status StatisticsITRDGCONTRSTATS
I_ACMTRDGCONTRACTUNITOFMEASUREInterface View For ACM Trdg Contract UOMIACMUOM
I_ACMTRDGCONTRAPPLDOCQTYDATAApplDocument Data(/ACCGO/T_APPDATA)IAPPLDOCDATA
I_ACMTRDGCONTRBUSDATADETTrading Contract Business Data DetailsIACMTCBUSDATA
I_ACMTRDGCONTRBUSFORMNTNCONTRTrading Contract Business Details for Maintain Contract AppIACMTCBUSMNTNAPP
I_ACMTRDGCONTRCOMMODITYSUBITEMCommodity Sub Item DataICOMSUBITEM
I_ACMTRDGCONTRCONDITIONNMBRInterface view for Tradg Cont Cndn NmbrICONTCONDNMBR
I_ACMTRDGCONTRCOUNTERPARTYVHInterface View for Counter Party Details with Org DataIMNTNTCCNTPTVH
I_ACMTRDGCONTRDYNQTYDETSDynamic Qty Types Base ViewICNTDQTDETS
I_ACMTRDGCONTRDYNQTYDETSCUBETrading Contract Dynamic Qty Detail CubeITRCONDYNQTYCUBE
I_ACMTRDGCONTRDYNQTYDETSEXTNExtension View for Dynamic Qty TypesICNTDQTDETSEXTN
I_ACMTRDGCONTREXTIDENTIFIERTrading Contract External IdentifierIACMCNTREXTIDF
I_ACMTRDGCONTRHDRDETTrading Contract Header DetailsIACMTCHDRDET
I_ACMTRDGCONTRHDRFLTRDETTrading Contract Header Filter detailIACMTCHDRFLTDET
I_ACMTRDGCONTRHDRFORMNTNCONTRTrading Contract Header Details for Maintain Contract AppIACMTCHDRMNTNAPP
I_ACMTRDGCONTRHDRFORPRCGCNDNTrading Contract Header Details for Pricing ConditionIACMTCHDRPRCGCND
I_ACMTRDGCONTRHDRFORPRCGOVWTrading Contract Header Details for pricing OverviewIACMTCHDRPRCOVW
I_ACMTRDGCONTRINCOTERMSCLFNVHValue Help for IncotermsIINCOTERMVH
I_ACMTRDGCONTRITEMFORPRCGOVWTrading Contract Item Details for pricing overviewsIACMTCITMPRCOVW
I_ACMTRDGCONTRITEMFWDAPPLDETSACM Trading Contract Frwd Appl DetsIFORWARDAPPLDETS
I_ACMTRDGCONTRITMCANCEVENTContract Item Cancellation Event InfoIACMCNTRCANCEVNT
I_ACMTRDGCONTRITMCANCEVENTDETSInterface View Item Canc Event DetailsIITMCANCEVENTDET
I_ACMTRDGCONTRITMCANCEVENTINFOContract Item Cancellation Event InfoIATCITMCANCEVENT
I_ACMTRDGCONTRITMINFOInterface view for Tradg Cont Item InfoICONTITEMINFO
I_ACMTRDGCONTRITMLINKEDQTYACM Trading Contract Item all quantitiesICONITMALLNKDQTY
I_ACMTRDGCONTRITMRELATEDTRADESInterface View for Item Related TradesIATCITMRELTRD
I_ACMTRDGCONTRITMRELTRADETYPERelated Trade TypesIACMTRCOITMRLTRD
I_ACMTRDGCONTRNONPRCDDETAILSInterface View for Trading Contract NPE Price Lot DetailsICONTRPRCGNPEDET
I_ACMTRDGCONTRPARTFORMNTNCONTRTrading Contract Partner Details for Maintain Contract AppIACMTCPARMNTNAPP
I_ACMTRDGCONTRPRCBRIDGEDETSCPE to Pricing Aspects BridgeIPRICEBRIDGE
I_ACMTRDGCONTRPRCCOMPDATAInterface View for Price Component DataICONTPRCCOMPDATA
I_ACMTRDGCONTRPRCFIXATIONDETSInterface View for Cont Price Fix DetailICONTPRCFIXDETS
I_ACMTRDGCONTRPRCGLOTFEEDETAILTrading Contract Price Lot Fee DetailsIACMCONTPLOTFEE
I_ACMTRDGCONTRPRCGTERMDATAInterface view for Contr Prcg Term DataICONTPRCTERMDATA
I_ACMTRDGCONTRPRCGVERSIONDETSInterface view for Trading Contract Pricing Vesrion DetailsITCPRCVERSDETS
I_ACMTRDGCONTRPRICELOTFEEDETSInterface Layer for Contr Hdr Fee DataIACMPRCFEEDATA
I_ACMTRDGCONTRPRICELOTFEEOVWInterface View for Contract Header FeesITCPRCFEEOVW
I_ACMTRDGCONTRPRICINGASPECTDETBaisc View For Trading Contract Pricing Aspect DetailsITRDGCONTRPRASP
I_ACMTRDGCONTRPRICINGELEMENTPricing ElementIACMTCPRCELEMENT
I_ACMTRDGCONTRPRSPECFORPRCGOVWTrading Contract Price Fixation for Pricing OverviewIACMTCPRFIXOVW
I_ACMTRDGCONTRPURCHASINGGRPVHPurchasing Group Value HelpIPURCGROUPVH
I_ACMTRDGCONTRPURCHASINGORGVHPurchase Organization Value HelpIPURCHORGVH
I_ACMTRDGCONTRRETURNAPPDATAACM Contract Return Application DataIRETURNAPPDATA
I_ACMTRDGCONTRSALESDIVISIONVHSales Division Value HelpISALWSDIVNVH
I_ACMTRDGCONTRSALESORGVHSales Organization Value HelpISALESORGAVH
I_ACMTRDGCONTRSETTLMTLINKDETSACM Contract Settlement Link detailsISETLMNTLINKDET
I_ACMTRDGCONTRSTATUSCATEGORYACM Trading Contract Status CategoryITRDGCONTRCTGRY
I_ACMTRDGCONTRSTATUSMAPPINGTrading Contract Status MappingITRCONTRSTATMAP
I_ACMTRDGCONTRSTATUSOVWACM Trading Contract Status OverviewICONTSTATUSOVW
I_ACMTRDGCONTRTRADEOFFICEDETSInterface View for Trade Office Details of Trading ContractITRDGCONTTRDOFC
I_ACMTRDGCONTRTYPEWITHSIDEInterface View for Trading Contract Type with SideITRDGCONTTYPWTSD
I_ACMTRDGCONTRWASHOUTDETAILTrading Contract: Washout DetailsIACMWASHOUTDET
I_ACMUNITOFMEASURETEXTInterface View for ACM UOM TextIACMUOMTEXT
I_ACMUNIVERSALTICKETDOCFLOWUniversal Ticket Document FlowIUNIVTDF
I_ACMUNIVERSALTICKETERRORLOGUniversal Ticket Error LogIUNIVTERLOG
I_ACMUNIVERSALTICKETHEADERUnivaersal Ticket HeaderIUNIVTH
I_ACMUNIVERSALTICKETITEMUniversal Ticket ItemIUNIVTI
I_ACMUSERAUTHORIZATIONDETAILSInterface for User Authorization DetailsIACMUSRAUTHDTL
I_ACMVALUATIONPOINTVHValue Help for Valuation PointVALNPTVH
I_ACMVERSIONEDLOGISTICDOCUMENTVersioned pricing data of logistic docsIACMVLOGP
I_ACM_APPLDOCNOMINATIONDATAACM Appl &Nom Linking(/ACCGO/T_CASCAI)IAPPLNOMDETS
I_ACM_DPQSCHARACTERISTICSBasic View on DPQS Overrides CharacteristicsIACMDPQSCHAR
I_ACM_DPQSCHARCSDETSInterface view for Trading Contract DPQS CharacteristicsIACMDPQSCHARSDET
I_ACM_DPQSHEADERBasic View on DPQS OverridesIDPQSHD
I_APPLICATIONDOCUMENTITEMACM Basic View For CA Application Document ItemIACMCASCAI
I_APPLICATIONLATESTREVRECACM Quantity: Application Latest Rev RecILATESTREVREC
I_APPLICATIONLATESTVERSIONACM: Application Latest VersionIAPPLATESTVER
I_APPLICATIONQUANTITYDATAACM: Quantity Application DataIAPPQTYDATA
I_ASSIGNMENTDATAACM Qty: Assignment DataIASSIGNMENT
I_CANCELLATIONcancellationPCANCELLATION
I_CASRLVTPURTYPEACM Basic View For CAS relevant purchase document typesIACMCASPURTYP
I_CHANGEDBYUSERInterface Layer for user detailsICHNGDBYUS
I_CMMDTYBEGPOSPNLVALUECUBEPnL value for Beginning Position - CubeICMMBPPNLVALCUBE
I_CMMDTYPRCGTRMGRPGGENRESCPE Term Change GroupingITRMGRPGRES
I_CMMDTYPRCGTRMGRPGGENRSLTCPE Term Changed Grouping and General Term ResultITRMGRPGRSLT
I_CMMDTYPRCGTRMINPTGENDATACPE Term Changed Input for General DataITRMINPUTGEN1
I_CMMDTYPRCGTRMOUTPUTGENDATACPE Term - General ResultIPRCTERMOUT
I_COMMODITYMTMVALUECUBECube for MtM ValuesICMMDTYMTMVALC
I_COND_HEADERCondition HeaderPCONDHEADER
I_CONTITEMContract ItemPCONTRACTITEM
I_CONTRACTAPPLICATIONSTATUSTXTContract Application Status TextICNTRCTSTTXT
I_CONTRACTCUSTREFERENCEContract headerICONTCREF
I_CONTRACTEXTERNALIDENTIFIERContract External IdentifierICONTRTEXTIDFR
I_CONTRACTHEADContract headerPCONTHEADER
I_CONTRACTHEADADDLDATAACM Contract Header (WBHK Additional Data) - /ACCGO/T_CAKHDRPCONTHEADADD
I_CONTRACTSNAPSHOTInterface Layer: Manage Snapshot ApplICNTRCTSNP
I_CONTRACTSNAPSHOTHEADERLEVELACM Contract Snapshot for Header LevelICNTRCTSNPHDRLVL
I_CONTRACTSNAPSHOTITEMLEVELACM Contract Snapshot for Item LevelICNTRCTSNPITMLVL
I_CONTRBPPNLVALUECUBEACM Cube for Contract BP PnL ValuesIACMBPPNLVALCUBE
I_CONTRMTMVALNPTBASICContract MtM Valuation Point Basic ViewIACMMTMVALPT
I_CONTRMTMVALNPTTXTContract MtM Valuation Point textIACMMTMVALPTTXT
I_CONTRMTMVALUECUBEACM Cube for Contract MTM ValuesIACMMTMVALCUBE
I_CONTRNETBPPNLVALCUBENet Beg Position PnL CubeICTRNETBPPNLCUBE
I_CONTRPNLVALUECUBEACM Cube for Contract PnL ValuesIACMPNLVALCUBE
I_CONTRPRCATTRIBLOGSYNCACM Sync Data of Log. Price AttributesICONTPRCATRISYNC
I_CONTRVERSIONEDLOGPRCDOCACM Versioned Log Pricing DocumentsICONVERLOGPRCDOC
I_CONTSUBITEMCONSUMPTION VIEW for wbhdPCONTRACTSUBITEM
I_DISCPREMMTMMESSAGEMessages relevant for MTMIACMMTMMESSAGE
I_DISCPREMQLTYGOVANALYSISACM Basis View For Governing AnalysisIACMGOVANA
I_DISCPREMQLTYOVRCHARRANGEACM Basic View For DPQS Overrides Characteristics RangeIACMDPQSOCR
I_DISCPREMQLTYSCHEDCHARACM Basic View For DPQS CharacteristicsIACMDPQSC
I_DISCPREMQLTYSCHEDCHRANGEACM Basic View For DPQS Characteristics RangeIACMDPQSCR
I_DISCPREMQLTYSCHEDOVRDCHARACM Basic View for DPQS Override CharacteristicsIACMDPQSOC
I_DISCPREMQLTYSCHEDOVRDHDRACM Basic View for DPQS Overrides HeaderIDPQSOHEADER
I_DISCPREMQTYGLOBALCHARACM Basic View For Global Derived CharacteristicIACMGLOBCHAR
I_DISCPREMQTYSCHEDULEHEADERVolume Schedule for Daily Grain ReportIDGRDPQSH
I_DPQSDPQSPDPQS
I_FBOFBO DetailsPFBO_DET
I_INVOICEDLATESTSETUNITACM: Latest Invoiced Settlement UnitISTLINVLATEST
I_ITEMCOMMODITYCommodity itemPITEMCOMM
I_LATESTAPPLICATIONVERSIONACM: Application Latest VersionILATESAPPTVER
I_LATESTINVOICEDSETUNITACM: Latest Invoiced Settlement UnitISTLLATESTINV
I_LOADDATACAPTUREEVENTACM Basic View For UIS EventIACMLDCEVENT
I_LOADDATACAPTUREHDRACM Basic View For UIS HeaderIACMLDCHDR
I_LTSTQTYUINVCDSETTLMTUNITACM: Latest Invoiced Settlement UnitILTSTQTYUINVSET
I_MATERIALUNITOFMEASUREMaterial Unit Of MeasureIMATUOM
I_NETPOSDCSTRADINGPERIODCommodity DCS Trading PeriodINETDCSPER
I_NETPOSITIONREPORTCUBEPosition Report - CubeINETPOSREPCUBE
I_NETPOSITIONREPORTEXTNCommodity Position Report - ExtensionINETPOSREPEXTN
I_NETPOSITIONREPSLATECUBEPosition Slate Report - CubeINETPOSREPSLCUBE
I_NETPOSITIONRISKREPORTCUBECube View For Net Position Risk ReportINETPOSREPTCUBE
I_NETPOSITIONRISKREPORTEXTNExtension View For Net Position Risk Report CalculationINETPOSREPTEXTN
I_OBJECTSTATUSStatus Object Status BasicIOBJSTATUS
I_OBJECTSTATUSSETTLEMENTACM:Settlement Object StatusIOBJSTLSTAT
I_OBLIGATIONSTORAGELOCATIONObligation Storage LocationIOBLGSTRGLOC
I_OPTIONALITYOPTIONALITYPOPTIONALITY
I_PHYSCMMDTYFORMATERIALPhysical Commodity for MaterialIPHYSCMMDTYMAT
I_PNLNEWACTIVITYDELTAVALIntermediate view for Calculation of FxIACMPNLNADVAL
I_PNLNEWACTYDELTAVALCUBEDetla computationIACMPNLNADCUBE
I_POSREPCUBEPosition Report CubeIPOSREPCUBE
I_POSREPSLATECUBEPosition Report CubeIPOSREPSLATECUBE
I_PREPAYMENTAGREEMENTREQUESTPrepayment Request Tab Contract app I viewIACPPMGPART
I_PREPAYMENTAGRMTCONTRACTSPrepayment Agreement ContractsIPPMTCON
I_PREPAYMENTAGRMTFEEPrepayment Agreement FeeIACPPMGFEE
I_PREPAYMENTAGRMTNOMINATIONSPrepayment Agreement NominationsIPPMTNOM
I_PREPAYMENTINVALIDCONTRACTSPrepayment Agreement invalid contractsIPPMTINV
I_PREPAYMENTRELTERMSTYPEVHValue help View for Payment TermsIACPPMGPAYTERMVH
I_PREPAYMENTREQUESTVHValue help view for Prepayment RequestIACPPMGPRVH
I_QTYSETINDICATORSACM Quantity: Settlement IndicatorsIQTYSETIND
I_QTYSETUNITINDICATORSACM Quantity: Settlement IndicatorsIQTYSTLIND
I_QTYSETUNITINDICATORSNONACM: Settlement Ind Non StdIQTYSTLINDNS
I_QTYUINVCDSETTLMTUNITINDACM Quantity: Settlement IndicatorsIQTYUINVCDSETIND
I_QUANTITYAPPLICATIONDATAACM Quantity: Application DataIQTYAPPDATA
I_QUANTITYASSIGNMENTDATAACM Quantity: Assignment DataIQTYASSIGNMENT
I_QUANTITYREVRECINDICATORSACM Quantity: Rev Rec IndicatorsIQTYREVRECIND
I_QUANTITYSHADOWDATAACM Qty: Shadow Item DataIQTYSHADOW
I_REVRECQUANTITYINDICATORSACM Quantity: Rev Rec IndicatorsIREVRECQTYIND
I_SETTLEMENTHEADERUNITACM: Settlement Unit DataISTLHEADERUNIT
I_SETTLEMENTUNITDATAACM: Settlement Unit DataISTLUNITDATA
I_SETTLEMENTUNITHEADERACM: Settlement Unit DataISTLUNITHEADER
I_SETTLEMENTUNITITEMACM: Settlement Unit ItemISTLUNITITEM
I_SETTLMTHDRWTHOUTJESTACM: Settelement Unit HeaderISTLHDRWT
I_SHADOWITEMDATAACM Qty: Shadow Item DataISHADOWITEM
I_SNAPSHOTPURPOSESTATUSSnapshot Purpose Status Value HelpISNPPUR
I_SNAPSHOTPURPOSESTATUSTXTSnapshot Purpose TextIPURTT
I_SNAPSHOTPURPOSESTATUSVHF4 Help for Snapshot Purpose StatusISNPPURVH
I_SNAPSHOTSGNTRRELEVANTINDTXTSnapshot Signature Relevant TextISIGRELTT
I_SNAPSHOTSGNTRRELEVANTINDVHSnapsht Signature relevant indicator Val HlpISIGRELVH
I_SNAPSHOTSIGNATURESTATUSContract Snapshot Signature StatusISNPSIGST
I_SNAPSHOTSIGNATURESTATUSTXTContract Snapshot Signature Status TextISNPSIGSTT
I_STKMTMDISCPREMVALEXTNStock MTM With Quality Characteristics - with extensionISTKDPQSVALEXTN
I_STKMTMWITHQLTYCHARCSCUBEStock MTM With Quality Characteristics CubeIACMSTKQLTYCUBE
I_SUBACCOUNTSub AccountPSUBACCOUNT
I_TOLERANCETolerancePTOLERANCE
I_TRADINGCONTRACTPARTNERDETSInterface view for Trading Contract Partner detailsITCPARTNERDET
I_TRDGCONTITEMAPPLQTYDETSDATATrading Contract Item Application QtyITRCOAPPLDETQTY
I_TRDGCONTRBUSPARTLANGCNVRSNTrading Contract Business Partner Language ConversionITPAUM
I_TRDGCONTRFIELDCATALOGDATATrading Contract field catalog dataICONTFLDCATALOG
I_TRDGCONTRITEMAPPLLINKDETSTrading Contract Item Application QtyICONTITMAPPLDETS
I_TRDGCONTRITEMCANCQTYTrading Contract Item Cancelled QuantityITRCONITMCANCQTY
I_TRDGCONTRITEMCOMMONQTYTrading Contract Item Common QtyITRDCONTCMNQTY
I_TRDGCONTRITEMCONSUMEDQTYTrading Contract Item Consumed QtyITRGCONTCNSMQTY
I_TRDGCONTRITEMNEWQTYTYPESInterface View to get New Quantity TypesITRCONTDQTNEW
I_TRDGCONTRITEMORIGINALQTYTrading Contract Item Original QtyITRGCONTORIGQTY
I_TRDGCONTRITEMRETURNAPPDETSReturn Application DetailsIRADLINKDETS
I_TRDGCONTRITEMRETURNQTYDETSTrading Contract Item Return Qty DetailsITRCONRETQTYDET
I_TRDGCONTRITEMVEHICLEQTYTYPESQuantity Types for Vehicle ContractITRCONTDQTVEH
I_TRDGCONTRITMFNLSETLDQTYDETSFull Finally Settled Qty DetailsIFULLFNLSTLQTY
I_TRDGCONTRNUMBEROFPLANVEHICLENo.of Planned Vehicles for ContractITRCONPLANVEHNUM
I_TRDGCONTROVERFILLFIXQTYDETSTrading Contract Overfill Fixation QtyICONOVRFILFIXQTY
I_TRDGCONTRPARTADDRESSDETSInterface view for Trading Contract Partner Address detailsITCPARTADDET
I_TRDGCONTRPLANNEDQTYDETSPlanned Quantity Details Of ContractIPLANNEDQTYDETS
I_TRDGCONTRPRCGLOTDETSTrading contract pricing lot detailsICONTPRCGLOTDETS
I_TRDGCONTRPRVSNLSETLDQTYDETSProvisionally Settled Qty DetailsIPROVSTLQTYDETS
I_TRDGCONTRSNAPSHOTPROCSTATUSTrading Contract Processing StatusICONTPROCSTATUS
I_TRDGCONTRSNAPSHOTSTSSTSTCTrading Contr Snpshot Status StatisticISNPSHTSTSTATCS
I_TRDGCONTRSNPSHTDYNPROCSTATUSSnapshot Status for Dynamic fieldsICONTPROCDYNSTS
I_TRDGCONTRTRADERIDTEXTTrading Contract Trader ID TextICONTRTRADIDTXT
I_TRDGCONTRWASHOUTQUANTITYDETSTrading Contract Item Washout/Circle QtyITRCONTWSHOUTQTY
I_UINVCDNONSTDSETTLMTINDACM: Settlement Ind Non StdIUINVNSSETIND
P_ACCGO_SI_CON_PPMG_FEESPrepayment Contract FeesP_CON_PPFEESI
P_ACCGO_SI_PPMT_FEESPrepayment Fee DetailsP_PPMT_FEE_SI
P_ACMALLAPPLFINALFORRECONBASEFinal Application DataPRECONALLAPPLFD
P_ACMAPPLASSGMTQTYLATESTDISTRQty Assignment Dist. Data Latest VersionIAPPQTYDISTLTST
P_ACMAPPLDAPPLDOCDATABasic View for Application Document ItemPACMAPPLDOCDATA
P_ACMAPPLDOCDATABasic View for Application Document ItemPACMAPPDOCDATA
P_ACMAPPLICATIONASSGMTQTYDISTRApplication Assignment Quantity DistributionPAPPLQTYASSGMT
P_ACMAPPLICATIONDOCITEMCA Application document itemPACMAPDOCITM
P_ACMAPPLICATIONITEMDATAApplication Iem DataPCTRAPPLITM
P_ACMAPPLIEDAPPLICATIONDATAApplication Document DataPCTRAPPLDETS
P_ACMAPPLIEDAPPLLATESTVERIONLatest Application DataIAPPLLTSTVERS
P_ACMAPPLNOTRSRVDQTYApplication Not Reserved QuantityPRCDISTRAGGQTYF
P_ACMAPPLNOTRSRVDQTYPREPDATAApplication Quantity on Price LotsPAPPNTRSVDPREPD
P_ACMAPPLQTYDISTRFINALAppl Qty Distrib: Final DataPCTRAPPLASGDISF
P_ACMAPPLQTYDISTRPREPAREDATAAppl Qty Distrib: Prepare DataPCONTAPPLASGDIS
P_ACMAPPLQTYDISTRWITHNOTRSRVDApplication Quantity DistributionPRCDISTRQTY
P_ACMAPPLQTYTOTONPRCLOTApplication Quantity on Price LotsPQTYONPRCLOT
P_ACMAPPLTOTQTYDISTRATPRCLOTApplication Total Quantity DistributionPRCONCONQTYDIS
P_ACMAPPLUNASSGNLATESTDATETIMEUnassigned Application Latest RecordPACMAPPLUNASLDT
P_ACMBATCHSPLITCORRREPDATAView for Batch Split Correction report DataPACMBSPLITCORR
P_ACMBOGEYFINALDATABogey Condition final DataPBOGEYFINALDATA
P_ACMBOGEYPREPAREDATABogey: Prepare DataPACMBOGEYPREPD
P_ACMCANCELEDAGGREGATEDQTYTotal canceled quantity on each pricing lotPACMCANCAGGQTY
P_ACMCANCELEDQTYCONVERSIONCancelled Quantity: Unit ConversionPACMCANCQTYCONV
P_ACMCANCELEDQTYFINALDATACancelled Quantity: Final DataPACMCANCQTYFD
P_ACMCANCELEDQTYLATESTSQNCNMBRLast Cancelation Sequence No.PACMCANCLATESTSN
P_ACMCANCELEDQTYPERLINETotal canceled quantity on each pricing lotPACMCANCQTYPL
P_ACMCANCELEDQTYPREPAREDATAPrepare Cancelation DataPACMCANCPREPD
P_ACMCANCELEDQTYPREPBASEDATATotal canceled quantity on each pricing lotPACMCANCPREPBASE
P_ACMCANCELEDQTYTOTALONCONTRTotal canceled quantity on ContractPACMCANCTOT
P_ACMCANCELLATIONCODEVHPrivate View for Cancellation Code Value HelpPACMCANCCODEVH
P_ACMCMMDTYCONTRACTCANCLNPRCGCommodity Contract Cancellations Pricing Lot InformationPCMMDTYCONTPRCG
P_ACMCMMDTYPRCGCONDITIONDATACommodity Pricing Condition DataPPRCGCNDTNDATA
P_ACMCMMDTYPRICINGENGINEDATACPE DataPACMCPEDATA
P_ACMCMMDTYPRICINGTERMDATACommodity Pricing Term DataPPRCNGTERMDATA
P_ACMCOMMODITYCONTRACTCANCLNView on Commodity Contract Cancellation InformationPCMMDTYCONTRCANC
P_ACMCONSUMPTIONRULEVHConsumption Rule Value HelpPCONSRULEVH
P_ACMCONTRACTCOMMODITYSUBITEMBaisc View on Trading Contract: commodity sub itemsPCMMDTYSUBITM
P_ACMCONTRACTHEADERTrading Contract Header InformationPCONTRHEAD
P_ACMCONTRACTITEMADDLDATABasic View on ACM Contract Item (WBHI Additional Data)PCONTRITMADDL
P_ACMCONTRACTOPTIONBasic View on Contract OptionalityPCONTROPTN
P_ACMCONTRHEADERTEXTVHPrivate View for Header TextPACMCNTRHDRTXT
P_ACMCONTRITEMTEXTVHPrivate View for Item TextPACMCNTRITMTXT
P_ACMCONTROPTIONSCROPSEASONIDPrivate View for Contract Optionality Crop Session IdPCONTRCRPSESNID
P_ACMCONTROPTIONSMNSOFTRANSPVHPrivate View for Contract Optionality Means of TransportPCONTOPTMNSOTRNS
P_ACMCONTRPRCASPECTBRIDGRTERMCPE to Pricing Aspect BridgePPRCBRIDGETERM
P_ACMCONTRRPLCMTPRTYPEVALHELPReplacement Price Type Value HelpPCONTREPPRCTYPVH
P_ACMDPQSGOVANLPrivate View for Governing AnalysisGOVANLYS
P_ACMDPQSGOVANLYSPrivate View for Governing AnalysisPGOVANLYS
P_ACMFIRMBIDOFFERDETAILSBasic View on FBO DetailsPFBODETS1
P_ACMFORMULAGRPGGENERALRESPrivate view for I_ACMFormulaGrpgGeneralResult for Recon RepPFMLAGRPGENRS
P_ACMFORMULAGRPGGENERALRESULTCPE Formula Grouping and General ResultPFMLAGRPGENRSLT1
P_ACMGOVREGCDGoverning Region CodePGOVR
P_ACMGOVREGCODGoverning Region CodePGOVREG
P_ACMGOVWEIGHTCODEGoverning Weight CodeGOVWG
P_ACMGOVWGTGoverning Weight CodeP_GOVWGT
P_ACMLISTEDOPTIONSFORDCSDerivative Contrac Specification for Listed Options, FuturesPACMLSTDOPTNDCS
P_ACMMAPPINGDOCITEMDATPrivate view for I_ACMMappingDocItemData for Recon repPMAPGDOCDAT
P_ACMMAPPINGDOCITEMDATACPE Caller Mapping KNUMV and Document Item to GUIDPMAPPGDOCITM
P_ACMMNTNPRCNGMATURITYCODEMaintain Pricing Maturity CodePMNTNPRCNGMC
P_ACMNOTRSRVDOPENCONTRQTYNot Reserved Open Contract QuantityPCTRNOTRSVDQTY
P_ACMOPENCONTRCONVTOBASEUNITConversionn to Base UnitPCTRPRCASPQC
P_ACMOPENCONTRFILLBASEUNITContract Commodity Quantity in Base UnitsPCTRPRCASPBU
P_ACMOPENCONTRFILLCANCELEDQTYContract Pricing Aspect DataPCTRCANCQTY
P_ACMOPENCONTRFILLCNSMDQTYDATAOpen Contract: Consumed/Cancelled Quantity DataPRTCTRQTYDIS
P_ACMOPENCONTRFILLPRCASPCTDATAContract Pricing Aspect DataPCTRPRCASP
P_ACMOPENCONTRFILTERDATAFilter Contract DataPCTRFILTERDATA
P_ACMOPENCONTRPRCLOTWTHNTRSRVDOpen Contracts: Pricing lots with un reserved lotPOPENCTRPRASPWNR
P_ACMOPENCONTRPREPAREDATAPrepare Open Contract Quantity DataPOPENCTRPREPD
P_ACMOPENCONTRQTYFINALDATAOpen Contract: Final DataPROCTRQTYDIS
P_ACMOPENCONTRQTYTOTONPRCLOTOpen Contract Quantity on Price LotsPTQTYASPRCLOT
P_ACMOPENCONTRUPDATEDATAOpen Contract: Update DataPCTRPRLOTDATA
P_ACMOPENCTRFINALFORRECONBASEOpen Contract DataPRECONOPENCTRFD
P_ACMPHYSICALCOMMODITYDATAPhysical Commodity DataPACMPHYSCMDDATA
P_ACMPRCGFIXREVIEWDETSPrice Fixation Details for Maintain Contract FIORI AppACMPRCFIXREDETS
P_ACMPRCRECONFILLERRORFIELDSRecon Pricing: Fill Error FieldsPRECONPRCERRFLD
P_ACMPRCRECONFILLREPORTINGDATARecon Price:Fill Reporting DataPRECONPRCREPD
P_ACMPRCRECONFILLTRANSACLDATARecon Price: Fill Transactional dataPRECONPRCTRANSD
P_ACMPRCRECONFINALDATARecon Price: Fill Final DataPRECONPRCFINAL3
P_ACMPRCRECONPREPAREBASEDATARecon Pricing:Prepare Base DataPRECONPRCTRAND
P_ACMPRCRECONUPDATEDATARecon Pricing: Update Quamtity and Price DataPRECONPRCUPD
P_ACMPRCRECONVLOGPFINALDATARecon VLOGP final DataPACMVLOGPDATAPRC
P_ACMPRCRECONVLOGPPREPAREDATAPrepare VLOGP Price DataPACMVLOGPPREPP
P_ACMPRCRECONVLOGPTERMNUMBERGet VLOGP Term NUmberPACMVLOGPTERM
P_ACMPRICEFIXATIONDATAPrivate View for Price Fixation DataPACMPRCFIXDATA
P_ACMPRICINGEXTENSIONDATACPE Extension data for the document item guidPCPEDEXTENSION
P_ACMPRICINGLOTSTATUSCPE DataPACMPRCLOTSTATUS
P_ACMQTYRECONFILLERRORFIELDSRecon: Fill Error FieldsPQTYRECONERRFLD
P_ACMQTYRECONFILLKONVDREPDATAFill Reporting DataPRECONKONVDD
P_ACMQTYRECONFILLPHYSCMMDTYFill Physical CommodityPRECONPHYSCOM
P_ACMQTYRECONFILLPMVUNITSRecon: Fill PMV UnitsPRECONPMVUNIT
P_ACMQTYRECONFILLREPORTINGDATAFill Reporting DataPRECONREPDATA2
P_ACMQTYRECONFILLTRANSACLDATAFill Transactional DataPRECONTRANS
P_ACMQTYRECONFILLVLOGPREPDATAFill Reporting DataPRECONVLOGPD
P_ACMQTYRECONFINALDATAFinal data for quantity reconciliation reportPQTYRECONFINALD
P_ACMQTYRECONKONVDAPPLLAQCalculate Application LAQPACMKONVDLAQQ
P_ACMQTYRECONKONVDCONVTOBASEKONVD Quantity FinalPACMKONVDCONVB
P_ACMQTYRECONKONVDFINALDATAKONVD Quantity FinalPACMKONVDDATA
P_ACMQTYRECONKONVDPREPAREDATAPrepare KNOVD DataPACMKONVDPREPD
P_ACMQTYRECONKONVDPREPDTFORLAQPrepare KNOVD DataACMKONVDPREPLAQ
P_ACMQTYRECONKONVDUPDATEDATAKONVD Quantity FinalPACMKONVDUPDDATA
P_ACMQTYRECONQTYCONVTOPMVUNITSQty conversion to PMV units for qty Reconciliation ReportPRECONPMVQCONV
P_ACMQTYRECONUPDATEDATAUpdate data for Quantity Reconciliation ReportPRECONUPDATED
P_ACMQTYRECONVLOGPFINALDATAVLOGP DataPACMVLOGPQTYCB
P_ACMQTYRECONVLOGPPREPAREDATAPrepare VLOGP DataPACMVLOGPPREPD
P_ACMRECONAPPLICATIONDATAACM Application DataPALLAPPLS
P_ACMRECONFILTERAPPLDATAFilter Application Data based on parametersPRECONAPPLFLTR
P_ACMRECONFINALAPPLDATAFinal Application DataPRECONAPPLFD
P_ACMRECONFINALUNRRLZDAPPLDATAUnrealized Application DataPACMUNRTD
P_ACMRECONPREPAREAPPLDATAPrepare Application DataPAPPLPREPD
P_ACMRECONUNRRLZDAPPQTYDISTRIBUnrealized Application Quantity DistributionPAPPLQTYDIST
P_ACMRETURNAPPLICATIONDATAReturn Application Document DataPRETAPPLDETS
P_ACMSETAPPLICATIONDETAILSLayer for application detailsPACMSEAPDET
P_ACMTOLSCHEDPrivate View for Tolerance SchedulePTOLSCHE
P_ACMTOLTYPPrivate View for Tolerance TypePACMTOLTYP
P_ACMTRADINGCONTRACTDETAILSPrivate View for Trading Contract Header DetailsPTRDGCONTRCTDTLS
P_ACMTRADINGCONTRACTHEADERTrading Contract Header DetailsPCONTRHEADER
P_ACMTRADINGCONTRACTITEMDATABasic View on Contract ItemPTRDGCONTRITM1
P_ACMTRADINGCONTRACTOVERVIEWTrading Contract Overview DetailsPCONTROVW
P_ACMTRADINGCONTRACTOVWACM Trading Contract OverviewPACMTRDGCTROVW
P_ACMTRANSACTIONALFEEDATABasic View on Transactional Fee DataPTRANSACLDATA1
P_ACMTRDGCONTRACTBUSINESSDATABasic View on Trading Contract Business DataPTRDGCONTRBUS1
P_ACMTRDGCONTRASSGMTDATAQuantity Assignment DataICONTRAPPLASG
P_ACMTRDGCONTRHDRDETSMNTNCONTRTrading Contract Header Details for Maintain Contract AppPACMTCHDRDTS
P_ACMTRDGCONTRHDRFORMNTNCONTRTrading Contract Header Details for Maintain Contract AppPACMTCHDRMNTNAPP
P_ACMTRDGCONTRITMLINKEDQTYACM Trading Contract Item all Linked QuantitiesPCONITMALLNKDQTY
P_ACMTRDGCONTRTYPEWITHSTATSGRPPrivate View for Contract Type with Status GroupPACMTCTYPSTATGRP
P_ACMUNIVERSALPARTIALTKTDATAUniversal Ticket DataPUNIVPTDATA
P_ACMUNIVERSALTICKETDATAUniversal Ticket DataPUNIVTDATA
P_ACMUNIVERSALTKTERRORLOGUniversal Ticket DataPUNIVTERLOG
P_ACMUNRLZDFINALFORRECONBASEUnrealized Quantity FinalPRECONURQFD
P_ACMVALNPTPrivate View for Valuation PointPVALNPT
P_ACMVERSIONEDLOGISTICDOCUMENTVersioned pricing data of logistic docsPACMVLOGP
P_ACM_DPQSCHARACTERISTICSBasic View on DPQS Overrides CharacteristicsPACMDPQSCHARCS
P_ACM_DPQSHEADERBasic View on DPQS OverridesPDPQSHD
P_APPLICATIONLATESTREVRECACM Quantity: Application Latest Rev RecPLATESTREVREC
P_APPLICATIONLATESTVERSION1ACM: Application Latest VersionPAPPLATESTVER1
P_APPLICATIONLATESTVERSION2ACM: Application Latest VersionPAPPLATESTVER2
P_ASSIGNEDDOCUMENTAssigned DocumentsP_ASGDOC
P_ASSIGNMENTDATAACM Qty: Assignment DataPASSIGNMENT
P_CAKOPTNContract Optionality DetailsPCAKOPTN
P_CMMDTYPRCGTRMGRPGGENRprivate view for I_CmmdtyPrcgTrmGrpgGenRslt for Recon ReportPTRMGRPGR
P_CMMDTYPRCGTRMGRPGGENRSLTCPE Term Changed Grouping and General Term ResultPTRMGRPGRSLT
P_CMMDTYPRCGTRMINPTGENDATTerm Input General DataPTRMINPUTGEN
P_CMMDTYPRCGTRMINPTGENDATACPE Term Changed Input for General DataPTRMINPUTGEN1
P_COMDTYORDREQTERMNOTerm number associated with CDOTE orderPCDOTETERMNO
P_COMDTYORDSTATUSLatest CDOTE Ord Status for the fixationPCDOTESTATUS
P_CONTRACTTYPESIDEDetermine Contract Type and SidePCNTRTYPESIDE
P_CONTRACTTYPEWITHSIDETrading Contract Type with respect to sidePCNTRWTHSIDE
P_CONTRMTMVALUECUBEContract MTM ValuesPACMMTMVALCUBE
P_CONTRNETBEGPNLCMMDTYBeg Position Commodity CubePNETBPPNLCMD
P_CONTRNETBEGPNLSTOCKMTMPrivate view to get Unapplied app docs from Stock MtMPNETBPPNLSTKMTM
P_CONTRNETBEGPNLTERMVALUEGet 02 records app docPNETBPPNLTERMVAL
P_CONTRNETBEGPNLUNAPPLIEDAPPSPrivate view for Net Beginning PnL to add unapplied AppsPNETPNLUNAPLAPPS
P_CONTRNETPNL_STKDELTADPQS_TFPrivate view to get Unapplied app docs from Stock MtMPNETBPPNLSTKTF
P_CONTRPOSREPVALUESACM Contract Position Report ValuesPACMPOSREPVAL
P_CONTRPOSREPVALUESYNCACM Contract Position Sync ValuesPACMPOSREPSYNC
P_CONTSUBITEMCONSUMPTION VIEW for wbhdPCONTSUBITEM
P_COUNTERPARTYTYPEVHValue Help for Counter PartyPCNTRPARTYVH
P_COUNTERPARTYWITHSIDEPrivate View four CounterParty with respect to sidePCNTRPRTYWTSD
P_CREDITSALEVHVehicle Contract IndicatorPCREDSALIND
P_DCSTRADINGMAXREFMONTHPrivate View To Get Max DCS Trading Month As Previous PeriodPDCSTRDGMAXREF
P_DCSTRADINGREFMONTHPrivate View For Getting Reference MonthPDCSTRADINGREF
P_DISCPREMQTYOVRDGOVTERMVHValue help for DPQS Governing TermPDPQSGOVTRM
P_DISTCHANNELTEXTDistribution Channel TextPDISTCHANNELTXT
P_KONVD_NETPOSITIONVers. pricing data (stock delta records)PKONVDNETPOS
P_KONVD_NETPOSITION_DENDRUNVers. pricing data (stock delta records)PKONVDNETPOSDEND
P_KONVD_NETPOSITION_PREP_DATAVers. pricing data (stock delta records)PKONVDNETPOSPD
P_KONVD_VLOGP_VALID_DATACMM_VLOGP and CMM_VLOGP_KONVD Valid Records for Net PositionPKNVDVLOGPVALDT
P_LATESTAPPLICATIONVERSION1ACM: Application Latest Version 1PLATESAPPTVER1
P_LATESTAPPLICATIONVERSION2ACM: Application Latest Version 2PLATESTAPPVER2
P_LATESTINVOICEDSETTLEMENTUNITACM: Latest Invoiced Settlement UnitPSTLLATESTINV
P_LDC_CASCAIACM View For App Doc and LDC DetailsPACMLDCCASCAI
P_LDC_DATALDC Header & Event DataPLDCDATA
P_LDC_W_STATUSLDC Data with StatusPLDCWSTATUS
P_LOGISTICALLYADJUSTEDAPPLQTYReturn Application Document DetailsPLAQAPPLQTY
P_NETPOSITIONCONVTOPHYUOMConvert VLOGP Quantity to Physical Commdity UomPNETPOSCONVTOP
P_NETPOSITIONREPORTSYNCSynchronized Net Dry Position ReportPNETPOSREPSYNC
P_NETPOSITIONRISKREPORTPrivate view for Net Position Risk ReportPNETPOSRISK
P_NETPOSITIONRSKREPORTAGGACM Net Position Risk ReportPNETPOSRSK
P_NETPOSITIONRSKREPORTCALCPrivate view for Net Position Risk Report CalculationPNETPOSRSKCALC
P_NETPOSITIONRSKREPORTNETCASHPrivate view for Net Position Risk Report CalculationPRSKRPTNETCASH
P_NETPOSITIONSLATEREPORTPosition Report CubePNETPOSREPSLATE
P_NETPOSITIONSLATEREPORT_PREPDSlate Position Report: Prepare DataPNETPOSREPSLPRPD
P_NETPOSITIONSLATEREPORT_UPDDSlate Position Report: Prepare DataPNETPOSREPSLUPDD
P_NETPOSITIONUPDATEPHYUOMUpdate Physical Commodity UomPNETPOSUPDPHYUOM
P_NETPOSITIONUPDATEPHYUOMQTYUpdate Physical Commodity Uom QuantitiesPNETPOSUPDPHYQTY
P_NETPOSITION_BINERRORCOUNTCount Number of Erroneous DocumentsPNETPOSBINERRCT
P_NETPOSITION_CMMDTYERRORCOUNTCount Number of Erroneous DocumentsPNETPOSCMMDTYEC
P_NETPOSITION_COMPOSITEKEYComposite Key FiguresPNETPOSCOMPKEY
P_NETPOSITION_DERIVATIVEPREPDDerivative Position Interface LayerPNETPOSFINPREPD
P_NETPOSITION_DERIVATIVEUPDDDerivative Position Interface LayerPNETPOSFINUPDD
P_NETPOSITION_ELEMENTARYKEYElementary Key Figures for Net Position ReportsPNETPOSELEMKEY
P_NETPOSITION_ERRORCNT_DENDRUNFind 02 Records having no A2 RecordsPKONVDERCTDEND
P_NETPOSITION_ERRORCNT_PREPDTFind 02 Records having no A2 RecordsPKONVDERCTPD
P_NETPOSITION_ERROR_FLAGSFill Error FlagsPVLOGPNETPOSERF
P_NETPOSITION_INVERSE_DODSignage Inverse for DODPNETPOSINVDOD
P_NETPOSITION_PREPARE_DATAPriced/UnpricedPVLOGPNETPOSPD
P_NETPOSITION_SIMPLEKEYSimple Key FiguresPNETPOSSIMPLEKEY
P_NETPOSITION_UNIONPHYSFINUnion view for Physicals and DerivativesPNETPOSUNIONPF
P_NETPOSITION_UPDATEDATAFill Error FlagsPVLOGPNETPOSUPD
P_NETPOSRISKRPTFIRSTLASTMNTHPvt View To Get First And Last Period Of DCS Trading MonthPDCSFIRLASTMNTH
P_NETPOSRISKRPTFSTLSTPREVMNTHPvt view to get First Last Prev Month of DCS Trading MonthPDCSFTLTPREV
P_NETPOSRISKRPTNETPOSITIONPrivate view for net Position Total CalculationPNETPOSRSKNETP
P_NETPOSRISKRPTNETPOSTOTALSPrivate view for calculating Net Position TotalsPNETPRKNETPOSTL
P_NETPOSRISKRPTPREVMONTHPrivate View To Get Previous DCS Trading MonthPNETPOSRSKPREV
P_NETPOSRISKRPTPREVPERIODPrivate View For Integrating Prev Period for Total FuturesPNETPOSPREVPR
P_NETPOSRISKRPTREPTPERIODPrivate view for calculating Reporting PeriodPNETPOSREPPERIOD
P_NETPOSRISKRPTUNIONPrivate view for Union of Net Positon ReportPNETPOSRISKUNION
P_NONINVOICEDSETTLEMENTUNITACM: Latest Invoiced Settlement UnitPSTLNONINV
P_ON_DEMAND_PRICE_ORDERFetch Price Details for tracking number of hitsPONDEMANDPRCODR
P_POSREP_SLATEPREPDATAPosition Report: Prepare Data for Slate ReportPPOSREPSLPRPDT
P_POSREP_UPDATEDATAUpdate Data for ACM Position ReportPPOSREPUPDTDATA
P_POSREP_UPDATEREPDATAUpdate Data for ACM Position ReportPPOSREPUPDTREPDT
P_PREPAYMENTREFERENCEDOCUMENTPrepayment Reference DocumentP_REFDOC
P_PRICEFIXATIONBASICDETAILSPrice Fixation Basic dataPPRCFIXBASDET
P_PRICEFIXATIONFUTUREDETAILSPrice Fixation Future DataPPRCFIXFUTDET
P_PRICEFIXATIONLOTDETAILSPrice Fixation Lot DataPPRCFIXLOTDET
P_PRICEFIXATIONNONHEDGEDETAILSPrice Fixation Non Hedgeable DataPPRCFIXNHDET
P_PRICEFIXATIONSECBASISDETAILSSecondary Basis Price Fixation DetailsPPRCFIXSBASDET
P_PRICEOVERRIDEREASONCODEVHPrice Override Reason CodePPRCOVRRCVH
P_PRICETYPEVHValue Help for FBO Target Price TypePTRGTPRCTYP
P_QREP_VERSIONCDS View to Get the latest Analysis VersionPACMQREPVER
P_REASON_CODE_TRACEFetching and Process of Reason Code TracingPREASONCODETRACE
P_RECONASSIGNMENTDATAACM Qty: Assignment DataPRECONASGMNT
P_SALESDIVISONTEXTSales Division TextPSALESDIVISONTXT
P_SALESORGPLANTPlant allowed per Sales OrganizationPSALESORGPLANT
P_SETTLEMENTLATESTCREATIONSettlement Unit Latest based on creationPTRDGCOSTLLATEST
P_SETTLEMENTUNITHEADERACM: Settlement Unit DataPSTLUNITHEADER
P_STOCK_DELTA_DPQS_VALUEStock Delta DPQS ValuePACMSTKDPQSVAL
P_TARGETCONTRACTTYPEVHTarget Contract Type VHPTRGTCONTRTYP
P_TOLERANCESCHEDULETolerance ScheduleOLERANCE
P_TRADINGCONTRACTHDRADDLACM Contract Header (WBHK Additional Data)PTRDGCTRHDRADDL
P_TRADINGCONTRACTOPENQTYACM Trading Contract Open QtyPTRDOPENQTY
P_TRADINGCONTRACTSIDEVALUEHELPTrading Contract Side Value HelpPTRDGCTRTSIDEVH
P_TRDGCONTITEMAPPLTOTALQTYContract Item Qty for all linked applPTRCONAPPLSUM
P_TRDGCONTRITEMAPPLLINKDETSTrading Contract Application Item dataPCONTITMAPPLDETS
P_TRDGCONTRITEMCALCCOMMONQTYCalculations to derive Common Qty for Contract ItemPTRDGCONCALCCOMN
P_TRDGCONTRITEMCLOSEDQTYClosed QuantityPCLOSEDQTYSUM
P_TRDGCONTRITEMCOMMONQTYTrading Contract Item Common QtyPTRDCONTCMNQTY
P_TRDGCONTRITEMDIFFCOMMONQTYCalculations to derive difference of applied qtyPTRDGCOMNDIFFQTY
P_TRDGCONTRITEMPLANNEDQTYInterface View to get New Quantity TypesPCONTRPLANQTY
P_TRDGCONTRITEMQUANTITYDATAACM Qty: Shadow Item DataICONTRITMQTY
P_TRDGCONTRITEMSETTLMNTDETSTrading Contrac Item Settlement DetailsPTRDGCOSTLDETS
P_TRDGCONTRITMACTVSETTLMTDETSActive Settlement DetailsPSTLACTVDETS
P_TRDGCONTRITMFNLSETLDQTYDETSTrading Contrac Item Finally Settled All QtyPFULLFNLSTLQTY
P_TRDGCONTRITMPRVSNLSETLDQTYProvisionally Settled Qty DetailsPPRVSTLQTYDETS
P_TRDGCONTRITMQTYLINKDUNIONTrading Contract item quantity details with UnionPCONQTYLNKDUNION
P_TRDGCONTRITMQTYLINKTYPEINDTrading Contract Quantity Type IndicatorPCONQTYLNKTYPIND
P_TRDGCONTRRETREVNRECGDAPPLQTYReturn Revenue Recognized Qty for an applicationPRETREVRECPPLQTY
P_TRDGCONTRRETURNSETLDAPPLQTYReturn Settled Qty for an applicationPRETSETLDAPPLQTY
P_VEHICLECONTRACTVHVehicle Contract IndicatorPVEHCLECNTIND
P_VLOGPKONVDUPDATEPHYUOMQTYUpdate Physical Commodity Uom QuantitiesPKONVDUPDTPHYQTY
P_VLOGPKONVD_CONVERTTO_PHYUOMConvert Konvd Quantity to Physical Commdity UomPKONVDCONTOPUOM
P_VLOGPKONVD_NETPOSITIONVers. pricing data (stock delta records)PVLOGPKONVDNPR
P_VLOGPKONVD_NETPOS_UPDTD_DATAVers. pricing data (stock delta records)PVLOGPKONVDUD
P_VLOGPKONVD_NETPOS_UPD_NETQTYVers. pricing data (stock delta records)PVLOGPKONVDUNQ
P_VLOGPKONVD_NP_FILL_PHYCMDTYFill Physical Commodity in Volgp KonvdPKONVDFPHYCMDTY
P_VLOGPKONVD_UPDATE_PHYUOMUpdate Physical Commodity Uom in KONVDPKONVDUPDPHYUOM

Other CDS Views